Follow us
Rabbit anti‑Bovine AATF Polyclonal RW-C658664-100
Antibody: AATF Rabbit anti-Bovine Polyclonal (pSer477) Antibody, Application: WB, Reactivity: Bovine, Mouse, Rat, Dog, Sheep, Xenopus, Non-Human Primate, Format: Unconjugated, Unmodified, Descriptio: AATF antibody RW-C658664 is an unconjugated rabbit polyclonal antibody to AATF (pSer477) from bovine. It is reactive with mouse, rat, bovine and other species. Validated for WB., Targe: Bovine AATF, Synonym: AATF | CHE1 | DED | Rb-binding protein Che-1 | CHE-1 | Protein AATF, Hos: Rabbit, Reactivit: Bovine, Mouse, Rat, Dog, Sheep, Xenopus, Non-Human Primate (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified from pooled serum, Modification: Unmodified, Epitop: pSer477, Application: Western blot, Presentatio: 10 mM HEPES, pH 7.5, 150 mM NaCl, 50% Glycerol, 100 ug/ml BSA, Storag: Store at -20°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AAT: Uniprot: Q9NY61 NCBI: NM_012138 NP_036270.1
469.00 € 469.0 EUR
Rabbit anti‑Human A4 / PLP2 IgG Polyclonal RW-C447574-100
Antibody: A4 / PLP2 Rabbit anti-Human Polyclonal (C-Terminus) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Monkey, Bovine, Dog, Pig, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: PLP2 antibody RW-C447574 is an HRP-conjugated rabbit polyclonal antibody to PLP2 (A4) (C-Terminus) from human. It is reactive with human, bovine, chimpanzee and other species. Validated for WB., Targe: Human A4 / PLP2, Synonym: PLP2 | A4 | A4-LSB | A4LSB | Intestinal membrane A4 protein | Proteolipid protein 2, Hos: Rabbit, Reactivit: Human, Chimpanzee, Monkey, Bovine, Dog, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human PLP2 (Q04941, NP_002659). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset, Sheep, Elephant, Panda, Dog, Bovine, Pig (100%); Galago, Mouse, Rat, Hamster, Rabbit, Horse, Guinea pig (92%)., Epitop: C-Terminus, Specificit: Human PLP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About A4 / PLP: Uniprot: Q04941 NCBI: NM_002668 NP_002659.1
442.00 € 442.0 EUR
Rabbit anti‑Human A4 / PLP2 IgG Polyclonal RW-C447572-100
Antibody: A4 / PLP2 Rabbit anti-Human Polyclonal (C-Terminus) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Monkey, Bovine, Dog, Pig, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: PLP2 antibody RW-C447572 is an FITC-conjugated rabbit polyclonal antibody to PLP2 (A4) (C-Terminus) from human. It is reactive with human, bovine, chimpanzee and other species. Validated for WB., Targe: Human A4 / PLP2, Synonym: PLP2 | A4 | A4-LSB | A4LSB | Intestinal membrane A4 protein | Proteolipid protein 2, Hos: Rabbit, Reactivit: Human, Chimpanzee, Monkey, Bovine, Dog, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human PLP2 (Q04941, NP_002659). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset, Sheep, Elephant, Panda, Dog, Bovine, Pig (100%); Galago, Mouse, Rat, Hamster, Rabbit, Horse, Guinea pig (92%)., Epitop: C-Terminus, Specificit: Human PLP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About A4 / PLP: Uniprot: Q04941 NCBI: NM_002668 NP_002659.1
442.00 € 442.0 EUR
Rabbit anti‑Human A4 / PLP2 IgG Polyclonal RW-C447571-100
Antibody: A4 / PLP2 Rabbit anti-Human Polyclonal (C-Terminus) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Monkey, Bovine, Dog, Pig, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: PLP2 antibody RW-C447571 is a biotin-conjugated rabbit polyclonal antibody to PLP2 (A4) (C-Terminus) from human. It is reactive with human, bovine, chimpanzee and other species. Validated for WB., Targe: Human A4 / PLP2, Synonym: PLP2 | A4 | A4-LSB | A4LSB | Intestinal membrane A4 protein | Proteolipid protein 2, Hos: Rabbit, Reactivit: Human, Chimpanzee, Monkey, Bovine, Dog, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human PLP2 (Q04941, NP_002659). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset, Sheep, Elephant, Panda, Dog, Bovine, Pig (100%); Galago, Mouse, Rat, Hamster, Rabbit, Horse, Guinea pig (92%)., Epitop: C-Terminus, Specificit: Human PLP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About A4 / PLP: Uniprot: Q04941 NCBI: NM_002668 NP_002659.1
442.00 € 442.0 EUR
Rabbit anti‑Human ACE / CD143 Polyclonal RW-C353970-100
Antibody: ACE / CD143 Rabbit anti-Human Polyclonal (Internal) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: CD143 antibody RW-C353970 is an unconjugated rabbit polyclonal antibody to CD143 (ACE) (Internal) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACE / CD143, Synonym: ACE | ACE1 | Angiotensin-converting enzyme | CD143 | CD143 antigen | Carboxycathepsin | DIPEPTIDYL CARBOXYPEPTIDASE | DCP | Dipeptidyl carboxypeptidase I | ICH | Kininase II | MVCD3 | Peptidyl-dipeptidase A | Peptidase P | DCP1 | Dipeptidyl carboxypeptidase 1 | Testicular ECA, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the central region of human CD143., Epitop: Internal, Specificit: Recognizes endogenous levels of CD143 protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACE / CD14: Uniprot: P12821 NCBI: NM_000789 NP_000780.1
299.00 € 299.0 EUR
Rabbit anti‑Human ACAN / Aggrecan Polyclonal RW-C351811-100
Antibody: ACAN / Aggrecan Rabbit anti-Human Polyclonal (N-Terminus) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: Aggrecan antibody RW-C351811 is an unconjugated rabbit polyclonal antibody to Aggrecan (ACAN) (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACAN / Aggrecan, Synonym: ACAN | AGCAN | Aggrecan core protein | Acg1 | Aggrecan | CSPG1 | CSPGCP | CSPCP | AGC1 | Aggrecan 1 | Large aggregating proteoglycan | MSK16 | SEDK | MCSPG, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the N-Terminus of human Aggrecan., Epitop: N-Terminus, Specificit: Recognizes endogenous levels of Aggrecan protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACAN / Aggreca: Uniprot: P16112 NCBI: NM_013227 NP_037359.3
299.00 € 299.0 EUR
Rabbit anti‑Human ACAA2 IgG Polyclonal RW-C451011-100
Antibody: ACAA2 Rabbit anti-Human Polyclonal (N-Terminus) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Rabbit, Sheep, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ACAA2 antibody RW-C451011 is an HRP-conjugated rabbit polyclonal antibody to ACAA2 (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACAA2, Synonym: ACAA2 | Acetyl-CoA acyltransferase 2 | Acetyl-CoA acyltransferase | Beta-ketothiolase | DSAEC | Beta ketothiolase, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Rabbit, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from N-Terminus of human ACAA2 (P42765, NP_006102). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Dog, Bovine, Bat, Rabbit, Guinea pig (100%); Pig, Opossum, Turkey, Chicken, Xenopus (92%); Beetle (90%); Platypus, Lizard, Salmon, Zebrafish (85%); Stickleback (84%)., Epitop: N-Terminus, Specificit: Human ACAA2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACAA: Uniprot: P42765 NCBI: NM_006111 NP_006102.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACAA2 IgG Polyclonal RW-C451010-100
Antibody: ACAA2 Rabbit anti-Human Polyclonal (N-Terminus) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Rabbit, Sheep, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ACAA2 antibody RW-C451010 is an FITC-conjugated rabbit polyclonal antibody to ACAA2 (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACAA2, Synonym: ACAA2 | Acetyl-CoA acyltransferase 2 | Acetyl-CoA acyltransferase | Beta-ketothiolase | DSAEC | Beta ketothiolase, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Rabbit, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from N-Terminus of human ACAA2 (P42765, NP_006102). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Dog, Bovine, Bat, Rabbit, Guinea pig (100%); Pig, Opossum, Turkey, Chicken, Xenopus (92%); Beetle (90%); Platypus, Lizard, Salmon, Zebrafish (85%); Stickleback (84%)., Epitop: N-Terminus, Specificit: Human ACAA2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACAA: Uniprot: P42765 NCBI: NM_006111 NP_006102.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACAA2 IgG Polyclonal RW-C451009-100
Antibody: ACAA2 Rabbit anti-Human Polyclonal (N-Terminus) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Rabbit, Sheep, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ACAA2 antibody RW-C451009 is a biotin-conjugated rabbit polyclonal antibody to ACAA2 (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACAA2, Synonym: ACAA2 | Acetyl-CoA acyltransferase 2 | Acetyl-CoA acyltransferase | Beta-ketothiolase | DSAEC | Beta ketothiolase, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Rabbit, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from N-Terminus of human ACAA2 (P42765, NP_006102). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Dog, Bovine, Bat, Rabbit, Guinea pig (100%); Pig, Opossum, Turkey, Chicken, Xenopus (92%); Beetle (90%); Platypus, Lizard, Salmon, Zebrafish (85%); Stickleback (84%)., Epitop: N-Terminus, Specificit: Human ACAA2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACAA: Uniprot: P42765 NCBI: NM_006111 NP_006102.2
469.00 € 469.0 EUR
Rabbit anti‑Human ABI1 / SSH3BP1 Polyclonal RW-C407631-10
Antibody: ABI1 / SSH3BP1 Rabbit anti-Human Polyclonal (aa151-175) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: SSH3BP1 antibody RW-C407631 is an unconjugated rabbit polyclonal antibody to SSH3BP1 (ABI1) (aa151-175) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ABI1 / SSH3BP1, Synonym: ABI1 | Abelson interactor 1 | Abl-interactor protein 1 long | ABI-1 | Abl-interactor 1 | Abl interactor 1 | Abl-binding protein 4 | ABLBP4 | NAP1BP | Nap1 binding protein | SSH3BP1 | Nap1-binding protein | E3B1 | Eps8-binding protein | Interactor protein AblBP4 | SSH3BP, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the N-Terminus of human ABI1 (151-175 aa HGVKWLKAKHGNNQPARTGTLSRTN), identical to the related mouse and rat sequences., Epitop: aa151-175, Specificit: Widely expressed, with highest expression in brain. ., Application: IHC
IHC - Paraffin (0.5 - 1 µg/ml)
Western blot (0.1 - 0.5 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: WB: The detection limit for SSH3BP1 is approximately 0.1 ng/lane under reducing conditions. IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections., Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABI1 / SSH3BP: Uniprot: Q8IZP0 NCBI: NM_005470 NP_005461.2
470.00 € 470.0 EUR
Rabbit anti‑Human ABI1 / SSH3BP1 Polyclonal RW-C312249-10
Antibody: ABI1 / SSH3BP1 Rabbit anti-Human Polyclonal (aa483-494) Antibody, Application: IHC, IHC-P, ICC, WB, Reactivity: Human, Monkey, Mouse, Rat, Bat, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: SSH3BP1 antibody RW-C312249 is an unconjugated rabbit polyclonal antibody to SSH3BP1 (ABI1) (aa483-494) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IHC and WB., Targe: Human ABI1 / SSH3BP1, Synonym: ABI1 | Abelson interactor 1 | Abl-interactor protein 1 long | ABI-1 | Abl-interactor 1 | Abl interactor 1 | Abl-binding protein 4 | ABLBP4 | NAP1BP | Nap1 binding protein | SSH3BP1 | Nap1-binding protein | E3B1 | Eps8-binding protein | Interactor protein AblBP4 | SSH3BP, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bat, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the C-Terminus of human ABI1 (483-494 aa WYEGVCNRVTGL), different from the related rat and mouse sequences by one amino acid., Epitop: aa483-494, Specificit: Widely expressed, with highest expression in brain. ., Application: IHC
IHC - Paraffin
ICC
Western blot, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Thimerosal, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABI1 / SSH3BP: Uniprot: Q8IZP0 NCBI: NM_005470 NP_005461.2
470.00 € 470.0 EUR
Rabbit anti‑Human ABHD5 IgG Polyclonal RW-C443773-100
Antibody: ABHD5 Rabbit anti-Human Polyclonal (aa101-150) (HRP) Antibody, Application: WB, Reactivity: Human, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ABHD5 antibody RW-C443773 is an HRP-conjugated rabbit polyclonal antibody to ABHD5 (aa101-150) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ABHD5, Synonym: ABHD5 | CDS | CGI-58 | IECN2 | NCIE2 | CGI58, Hos: Rabbit, Reactivit: Human, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa101-150 of human ABHD5 (Q8WTS1, NP_057090). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Panda, Dog, Bovine, Rabbit, Horse (100%); Elephant, Pig (92%); Bat, Guinea pig (85%)., Epitop: aa101-150, Specificit: Human ABHD5 / CGI-58, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABHD: Uniprot: Q8WTS1 NCBI: NM_016006 NP_057090.2
442.00 € 442.0 EUR
Rabbit anti‑Human ABHD5 IgG Polyclonal RW-C443772-100
Antibody: ABHD5 Rabbit anti-Human Polyclonal (aa101-150) (FITC) Antibody, Application: WB, Reactivity: Human, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ABHD5 antibody RW-C443772 is an FITC-conjugated rabbit polyclonal antibody to ABHD5 (aa101-150) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ABHD5, Synonym: ABHD5 | CDS | CGI-58 | IECN2 | NCIE2 | CGI58, Hos: Rabbit, Reactivit: Human, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa101-150 of human ABHD5 (Q8WTS1, NP_057090). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Panda, Dog, Bovine, Rabbit, Horse (100%); Elephant, Pig (92%); Bat, Guinea pig (85%)., Epitop: aa101-150, Specificit: Human ABHD5 / CGI-58, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABHD: Uniprot: Q8WTS1 NCBI: NM_016006 NP_057090.2
442.00 € 442.0 EUR
Rabbit anti‑Human ABHD5 IgG Polyclonal RW-C443770-100
Antibody: ABHD5 Rabbit anti-Human Polyclonal (aa101-150) (Biotin) Antibody, Application: WB, Reactivity: Human, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ABHD5 antibody RW-C443770 is a biotin-conjugated rabbit polyclonal antibody to ABHD5 (aa101-150) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ABHD5, Synonym: ABHD5 | CDS | CGI-58 | IECN2 | NCIE2 | CGI58, Hos: Rabbit, Reactivit: Human, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa101-150 of human ABHD5 (Q8WTS1, NP_057090). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Panda, Dog, Bovine, Rabbit, Horse (100%); Elephant, Pig (92%); Bat, Guinea pig (85%)., Epitop: aa101-150, Specificit: Human ABHD5 / CGI-58, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABHD: Uniprot: Q8WTS1 NCBI: NM_016006 NP_057090.2
442.00 € 442.0 EUR
Rabbit anti‑Human ABCG5 Polyclonal RW-C407630-10
Antibody: ABCG5 Rabbit anti-Human Polyclonal (aa197-221) Antibody, Application: WB, Reactivity: Human, Bovine, Dog, Sheep, Format: Unconjugated, Unmodified, Descriptio: ABCG5 antibody RW-C407630 is an unconjugated rabbit polyclonal antibody to ABCG5 (aa197-221) from human. It is reactive with human, bovine, dog and other species. Validated for WB., Targe: Human ABCG5, Synonym: ABCG5 | STSL | Sterolin | Sterolin 1 | Sterolin-1, Hos: Rabbit, Reactivit: Human, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the N-Terminus of human ABCG5 (197-221 aa ERRRVSIAAQLLQDPKVMLFDEPTT), different from the related mouse and rat sequences by two amino acids., Epitop: aa197-221, Specificit: Strongly expressed in the liver, lower levels in the small intestine and colon., Application: Western blot (0.1 - 0.5 µg/ml), Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCG: Uniprot: Q9H222 NCBI: NM_022436 NP_071881.1
470.00 € 470.0 EUR
Rabbit anti‑Human ACTB / Beta Actin Polyclonal RW-C351809-100
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal (N-Terminus) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Beta Actin antibody RW-C351809 is an unconjugated rabbit polyclonal antibody to Beta Actin (ACTB) (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the N-Terminus of human Beta-actin., Epitop: N-Terminus, Specificit: Recognizes endogenous levels of Beta-actin protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
267.00 € 267.0 EUR
Rabbit anti‑Human ACTB / Beta Actin Polyclonal RW-C413540-100
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal Antibody, Application: IHC, IHC-P, ICC, IF, WB, Reactivity: Human, Monkey, Mouse, Rat, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Beta Actin antibody RW-C413540 is an unconjugated rabbit polyclonal antibody to Beta Actin (ACTB) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IF, IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Recombinant protein corresponding to human Beta-actin., Specificit: Recognizes endogenous levels of Beta-actin protein., Application: IHC
IHC - Paraffin (1:200 - 1:500)
ICC (1:100 - 1:200)
Immunofluorescence (1:100 - 1:200)
Western blot (1:1000 - 1:3000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Aliquot and store at -20°C for 1 year. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
321.00 € 321.0 EUR
Rabbit anti‑Human ACTB / Beta Actin Polyclonal RW-C439807-100
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal (C-Terminus) (Biotin) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila, Insect, Format: Biotin, Unmodified, Other formats: FITC HRP Unconjugated, Descriptio: Beta Actin antibody RW-C439807 is a biotin-conjugated rabbit polyclonal antibody to Beta Actin (ACTB) (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila, Insect (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ACTB (P60709, NP_001092). Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Sheep, Hamster, Dog, Bovine, Rabbit, Horse, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Xenopus, Trout, Seabass, Salmon, Smelt, Medaka, Pufferfish, Zebrafish, Drosophila, Mosquito, Nematode (100%)., Epitop: C-Terminus, Specificit: Human ACTB / Beta-actin, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACTB / Beta Actin Polyclonal RW-C439808-100
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal (C-Terminus) (FITC) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila, Insect, Format: FITC, Unmodified, Other formats: Biotin HRP Unconjugated, Descriptio: Beta Actin antibody RW-C439808 is an FITC-conjugated rabbit polyclonal antibody to Beta Actin (ACTB) (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila, Insect (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ACTB (P60709, NP_001092). Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Sheep, Hamster, Dog, Bovine, Rabbit, Horse, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Xenopus, Trout, Seabass, Salmon, Smelt, Medaka, Pufferfish, Zebrafish, Drosophila, Mosquito, Nematode (100%)., Epitop: C-Terminus, Specificit: Human ACTB / Beta-actin, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACTB / Beta Actin Polyclonal RW-C439809-100
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal (C-Terminus) (HRP) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila, Insect, Format: Horseradish Peroxidase, Unmodified, Other formats: Biotin FITC Unconjugated, Descriptio: Beta Actin antibody RW-C439809 is an HRP-conjugated rabbit polyclonal antibody to Beta Actin (ACTB) (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila, Insect (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ACTB (P60709, NP_001092). Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Sheep, Hamster, Dog, Bovine, Rabbit, Horse, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Xenopus, Trout, Seabass, Salmon, Smelt, Medaka, Pufferfish, Zebrafish, Drosophila, Mosquito, Nematode (100%)., Epitop: C-Terminus, Specificit: Human ACTB / Beta-actin, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACTB / Beta Actin IgG Polyclonal RW-C154297-100
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal (aa350-375) (Biotin) Antibody, Application: IHC, WB, ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Goat, Guinea pig, Hamster, Pig, Sheep, Format: Biotin, Unmodified, Descriptio: Beta Actin antibody RW-C154297 is a biotin-conjugated rabbit polyclonal antibody to Beta Actin (ACTB) (aa350-375) from human. It is reactive with human, mouse, rat and other species. Validated for ELISA, IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Goat, Guinea pig, Hamster, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: beta-Actin Loading Control Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a C-Terminal region near amino acids 350-375 of Human beta Actin., Epitop: aa350-375, Specificit: A BLAST analysis was used to suggest that this antibody would react with beta Actin from a wide range of organisms, including most vertebrates and some yeast. Broad reactivity makes this antibody an excellent loading control., Application: IHC (1:1000 - 1:5000)
Western blot (1:2000 - 1:10000)
ELISA (1:100000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: This affinity-purified antibody has been tested for use in ELISA, immunohistochemistry and western blot. Specific conditions for reactivity should be optimized by the end user. Beta actin present in fibroblast connective tissue stains very brightly. Beta actin present in neuromuscular junctions also stains. Paraformaldehyde fixation yields brighter staining than formalin or methanol fixation. Expect a band at ~42 kD in size corresponding to beta actin by western blotting in the appropriate cell lysate or extract. The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: Lyophilized from 10 mg/mL BSA (Protease and Ig free), 0.02 M Potassium Phosphate, pH 7.2, 0.15 M NaCl, 0.01% Sodium Azide, Reconstitutio: Reconstitute in 100 µL of deionized water., Storag: Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
472.00 € 472.0 EUR
Rabbit anti‑Human ACTB / Beta Actin IgG Polyclonal RW-C154279-100
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal (aa350-375) (HRP) Antibody, Application: IHC, WB, ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Goat, Guinea pig, Hamster, Pig, Sheep, Format: Horseradish Peroxidase, Unmodified, Descriptio: Beta Actin antibody RW-C154279 is an HRP-conjugated rabbit polyclonal antibody to Beta Actin (ACTB) (aa350-375) from human. It is reactive with human, mouse, rat and other species. Validated for ELISA, IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Goat, Guinea pig, Hamster, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: beta-Actin Loading Control Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a C-Terminal region near amino acids 350-375 of Human beta Actin., Epitop: aa350-375, Specificit: A BLAST analysis was used to suggest that this antibody would react with beta Actin from a wide range of organisms, including most vertebrates and some yeast. Broad reactivity makes this antibody an excellent loading control., Application: IHC (1:500 - 1:2500)
Western blot (1:1000 - 1:5000)
ELISA (1:20000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Beta Actin Antibody Peroxidase Conjugated antibody has been tested for use in ELISA, immunohistochemistry and western blot. Specific conditions for reactivity should be optimized by the end user. Beta actin present in fibroblast connective tissue stains very brightly. Beta actin present in neuromuscular junctions also stains. Paraformaldehyde fixation yields brighter staining than formalin or methanol fixation. Expect a band at ~42 kD in size corresponding to beta actin by western blotting in the appropriate cell lysate or extract. The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: Lyophilized from 10 mg/mL BSA (Protease and Ig free), 0.02 M Potassium Phosphate, pH 7.2, 0.15 M NaCl, 0.01% Gentamicin. Do NOT add Sodium Azide, Reconstitutio: Reconstitute in 100 µL of deionized water., Storag: Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
472.00 € 472.0 EUR
Rabbit anti‑Human ACTB / Beta Actin IgG Polyclonal RW-B323-50
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal (aa350-375) Antibody, Application: IHC, IHC-P, IF, WB, ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Goat, Guinea pig, Hamster, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: Beta Actin antibody RW-B323 is an unconjugated rabbit polyclonal antibody to Beta Actin (ACTB) (aa350-375) from human. It is reactive with human, mouse, rat and other species. Validated for ELISA, IF, IHC and WB. Tested on 20 paraffin-embedded human tissues., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Goat, Guinea pig, Hamster, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Beta-Actin Loading Control Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to C-Terminal region near amino acids 350-375 of Human beta Actin., Epitop: aa350-375, Specificit: Reacts with Human, Rat, Monkey and Mouse. beta-Actin Loading Control Antibody is expected to cross-react with a wide range of species due to sequence homology. Anti-Beta Actin is affinity-purified antibody is directed against human beta Actin protein. A BLAST analysis was used to suggest that this antibody would react with beta Actin from a wide range of organisms, including most vertebrates and some yeast. Broad reactivity makes this antibody an excellent loading control., Application: IHC
IHC - Paraffin (5 µg/ml)
Immunofluorescence (1:500 - 1:2000)
Western blot (1:1000 - 1:4000)
ELISA (1:10000 - 1:40000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Immunohistochemistry: RW-B323 was validated for use in immunohistochemistry on a panel of 21 formalin-fixed, paraffin-embedded (FFPE) human tissues after heat induced antigen retrieval in pH 6.0 citrate buffer. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen. The stained slides were evaluated by a pathologist to confirm staining specificity. The optimal working concentration for RW-B323 was determined to be 5 ug/ml.Antibody has been tested in IHC with human and frog samples and in Western blot with human and mouse samples. It is expected to react with a wide range of species due to sequence homology., Presentatio: 0.02 M Potassium Phosphate, pH 7.2, 0.15 M NaCl, 0.01% Sodium Azide, Storag: Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles. Store undiluted., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
485.00 € 485.0 EUR
Rabbit anti‑Human ACTB / Beta Actin IgG1 Polyclonal RW-C825741-100
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal Antibody, Application: IHC, IF, WB, Reactivity: Human, Monkey, Mouse, Rat, Hamster, Sheep, Chicken, Xenopus, Format: Unconjugated, Unmodified, Descriptio: Beta Actin antibody RW-C825741 is an unconjugated rabbit polyclonal antibody to Beta Actin (ACTB) from human. It is reactive with human, mouse, rat and other species. Validated for IF, IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Hamster, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG1 Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Application: IHC (1:200)
Immunofluorescence (1:200)
Western blot (1:3000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol., Storag: Store at -20°C for up to 1 year. Do not aliquot the antibody., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
308.00 € 308.0 EUR
Mouse anti‑Human ACTB / Beta Actin IgG1 Monoclonal RW-C780563-100
Antibody: ACTB / Beta Actin Mouse anti-Human Monoclonal (5B7) Antibody, Application: IHC, WB, Reactivity: Human, Monkey, Mouse, Rat, Dog, Hamster, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Beta Actin antibody RW-C780563 is an unconjugated mouse monoclonal antibody to Beta Actin (ACTB) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Mouse, Reactivit: Human, Monkey, Mouse, Rat, Dog, Hamster, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: IgG1 Monoclonal, Clon: 5B7, Conjugation: Unconjugated, Modification: Unmodified, Application: IHC (1:100)
Western blot (1:2000 - 1:5000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: PBS (without Mg2+, Ca2+), pH 7.4, 150 mM NaCl, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
308.00 € 308.0 EUR
Mouse anti‑Human ACTB / Beta Actin IgG1 Monoclonal RW-C780120-100
Antibody: ACTB / Beta Actin Mouse anti-Human Monoclonal (5B7) Antibody, Application: IHC, IF, WB, Reactivity: Human, Monkey, Mouse, Rat, Dog, Hamster, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Beta Actin antibody RW-C780120 is an unconjugated mouse monoclonal antibody to Beta Actin (ACTB) from human. It is reactive with human, mouse, rat and other species. Validated for IF, IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Mouse, Reactivit: Human, Monkey, Mouse, Rat, Dog, Hamster, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: IgG1 Monoclonal, Clon: 5B7, Conjugation: Unconjugated, Modification: Unmodified, Application: IHC (1:200)
Immunofluorescence (1:200)
Western blot (1:5000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: PBS (without Mg2+, Ca2+), pH 7.4, 150 mM NaCl, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
308.00 € 308.0 EUR
Mouse anti‑Human ACTB / Beta Actin IgG1 Monoclonal RW-C779870-100
Antibody: ACTB / Beta Actin Mouse anti-Human Monoclonal (5B7) Antibody, Application: IHC, IF, WB, Reactivity: Human, Monkey, Mouse, Rat, Dog, Hamster, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Beta Actin antibody RW-C779870 is an unconjugated mouse monoclonal antibody to Beta Actin (ACTB) from human. It is reactive with human, mouse, rat and other species. Validated for IF, IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Mouse, Reactivit: Human, Monkey, Mouse, Rat, Dog, Hamster, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: IgG1 Monoclonal, Clon: 5B7, Conjugation: Unconjugated, Modification: Unmodified, Application: IHC (1:200)
Immunofluorescence (1:200)
Western blot (1:5000 - 1:10000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: PBS (without Mg2+, Ca2+), pH 7.4, 150 mM NaCl, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
308.00 € 308.0 EUR
Mouse anti‑Human ACTB / Beta Actin IgG1 Monoclonal RW-C778409-100
Antibody: ACTB / Beta Actin Mouse anti-Human Monoclonal (A02) Antibody, Application: IHC, IF, WB, Reactivity: Human, Monkey, Mouse, Rat, Dog, Hamster, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Beta Actin antibody RW-C778409 is an unconjugated mouse monoclonal antibody to Beta Actin (ACTB) from human. It is reactive with human, mouse, rat and other species. Validated for IF, IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Mouse, Reactivit: Human, Monkey, Mouse, Rat, Dog, Hamster, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: IgG1 Monoclonal, Clon: A02, Conjugation: Unconjugated, Modification: Unmodified, Application: IHC (1:200)
Immunofluorescence (1:200)
Western blot (1:5000 - 1:10000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: PBS (without Mg2+, Ca2+), pH 7.4, 150 mM NaCl, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
308.00 € 308.0 EUR
Rabbit anti‑Human ACTB / Beta Actin IgG Polyclonal RW-C745297-25
Antibody: ACTB / Beta Actin Rabbit anti-Human Polyclonal (aa350-375) Antibody, Application: IHC, IF, WB, ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Goat, Guinea pig, Hamster, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: Beta Actin antibody RW-C745297 is an unconjugated rabbit polyclonal antibody to Beta Actin (ACTB) (aa350-375) from human. It is reactive with human, mouse, rat and other species. Validated for ELISA, IF, IHC and WB., Targe: Human ACTB / Beta Actin, Synonym: ACTB | Actin, cytoplasmic 1 | Beta-actin | Beta actin | BRWS1 | Actin, beta | Beta cytoskeletal actin | PS1TP5-binding protein 1 | PS1TP5BP1, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Goat, Guinea pig, Hamster, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Beta-Actin Loading Control Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to C-Terminal region near amino acids 350-375 of Human beta Actin., Epitop: aa350-375, Specificit: Reacts with Human, Rat, Monkey and Mouse. beta-Actin Loading Control Antibody is expected to cross-react with a wide range of species due to sequence homology. Anti-Beta Actin is affinity-purified antibody is directed against human beta Actin protein. A BLAST analysis was used to suggest that this antibody would react with beta Actin from a wide range of organisms, including most vertebrates and some yeast. Broad reactivity makes this antibody an excellent loading control., Application: IHC
Immunofluorescence (1:500 - 1:2000)
Western blot (1:1000 - 1:4000)
ELISA (1:10000 - 1:40000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: 0.02 M Potassium Phosphate, pH 7.2, 0.15 M NaCl, 0.01% Sodium Azide, Storag: Store vial at -20°C or below prior to opening. Dilute 1:10 to minimize loss. Store the vial at -20°C or below after dilution. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTB / Beta Acti: Uniprot: P60709 NCBI: NM_001101 NP_001092.1
304.00 € 304.0 EUR
Mouse anti‑Human ACTA2 / Smooth Muscle Actin IgG2a Monoclonal RW-C146642-50
Antibody: ACTA2 / Smooth Muscle Actin Mouse anti-Human Monoclonal (IA4) Antibody, Application: IHC, IHC-Fr, WB, ELISA, EM, Reactivity: Human, Mouse, Rat, Goat, Pig, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Smooth Muscle Actin antibody RW-C146642 is an unconjugated mouse monoclonal antibody to Smooth Muscle Actin (ACTA2) from human. It is reactive with human, mouse, rat and other species. Validated for ELISA, EM, IHC and WB., Targe: Human ACTA2 / Smooth Muscle Actin, Synonym: ACTA2 | ACTVS | Alpha-actin-2 | Alpha-cardiac actin | AAT6 | Actin, aortic smooth muscle | ACTSA | Smooth Muscle Actin | MYMY5 | SMA, Hos: Mouse, Reactivit: Human, Mouse, Rat, Goat, Pig, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: IgG2a Monoclonal, Clon: IA4, Conjugation: Unconjugated, Purificatio: Purified, Modification: Unmodified, Immunoge: Peptide comprising the first 10 amino acids of alpha-smooth muscle actin with an acetylated N-Terminus coupled to keyhole limpet hemocyanin via the C-Terminus cysteine (Ac-EEEDSTALVC)., Specificit: Reacts exclusively with alpha-smooth muscle actin, which is typical for vascular and visceral smooth muscle cells, but which is also present in myofibroblasts. The epitope is Ac-EEED, and is highly conserved. Therefore, the antibody cross-reacts with many species including protochordates, lower craniates and mammals., Application: IHC
IHC - Frozen (1:10 - 1:100)
Western blot (1:10000 - 1:50000)
ELISA
Electron Microscopy, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Failed Application: IHC - Paraffin, Presentatio: PBS, 0.09% Sodium Azide, Storag: Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTA2 / Smooth Muscle Acti: Uniprot: P62736 NCBI: NM_001613 NP_001604.1
470.00 € 470.0 EUR
Rabbit anti‑Human ACTA2 / Smooth Muscle Actin Polyclonal RW-C761109-30
Antibody: ACTA2 / Smooth Muscle Actin Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Pig, Sheep, Chicken, Zebrafish, Format: Unconjugated, Unmodified, Descriptio: Smooth Muscle Actin antibody RW-C761109 is an unconjugated rabbit polyclonal antibody to Smooth Muscle Actin (ACTA2) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACTA2 / Smooth Muscle Actin, Synonym: ACTA2 | ACTVS | Alpha-actin-2 | Alpha-cardiac actin | AAT6 | Actin, aortic smooth muscle | ACTSA | Smooth Muscle Actin | MYMY5 | SMA, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Pig, Sheep, Chicken, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-term region of human Actin-pan. The exact sequence is proprietary., Specificit: Recognizes endogenous levels of Actin-pan protein., Application: Western blot (1:500 - 1:1000), Usag: Applications should be user optimized., Presentatio: 0.42% Potassium Phosphate, pH 7.3, 0.87% NaCl, 0.01% Sodium Azide, 30% Glycerol, Storag: Upon delivery, aliquot and store at -20°C for 1 year. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTA2 / Smooth Muscle Acti: Uniprot: P62736 NCBI: NM_001613 NP_001604.1
351.00 € 351.0 EUR
Rabbit anti‑Human ACTA1 / Skeletal Muscle Actin Polyclonal RW-C468157-100
Antibody: ACTA1 / Skeletal Muscle Actin Rabbit anti-Human Polyclonal (aa50-99) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Drosophila, Insect, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: Skeletal Muscle Actin antibody RW-C468157 is an HRP-conjugated rabbit polyclonal antibody to Skeletal Muscle Actin (ACTA1) (aa50-99) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACTA1 / Skeletal Muscle Actin, Synonym: ACTA1 | ACTA | Actin, alpha skeletal muscle | Alpha-actin-1 | CFTD | CFTD1 | CFTDM | MPFD | NEM1 | NEM2 | ASMA | NEM3, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Drosophila, Insect (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa50-99 of human ACTA1 (P68133, NP_001091). Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Sheep, Hamster, Dog, Bovine, Rabbit, Horse, Pig, Guinea pig, Chicken, Xenopus, Salmon, Medaka, Pufferfish, Blood fluke, Drosophila, Mosquito, Slime mold, Nematode, Amoeba (100%)., Epitop: aa50-99, Specificit: Human ACTA1 / ASMA, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTA1 / Skeletal Muscle Acti: Uniprot: P68133 NCBI: NM_001100 NP_001091.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACTA1 / Skeletal Muscle Actin Polyclonal RW-C468156-100
Antibody: ACTA1 / Skeletal Muscle Actin Rabbit anti-Human Polyclonal (aa50-99) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Drosophila, Insect, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: Skeletal Muscle Actin antibody RW-C468156 is an FITC-conjugated rabbit polyclonal antibody to Skeletal Muscle Actin (ACTA1) (aa50-99) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACTA1 / Skeletal Muscle Actin, Synonym: ACTA1 | ACTA | Actin, alpha skeletal muscle | Alpha-actin-1 | CFTD | CFTD1 | CFTDM | MPFD | NEM1 | NEM2 | ASMA | NEM3, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Drosophila, Insect (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa50-99 of human ACTA1 (P68133, NP_001091). Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Sheep, Hamster, Dog, Bovine, Rabbit, Horse, Pig, Guinea pig, Chicken, Xenopus, Salmon, Medaka, Pufferfish, Blood fluke, Drosophila, Mosquito, Slime mold, Nematode, Amoeba (100%)., Epitop: aa50-99, Specificit: Human ACTA1 / ASMA, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTA1 / Skeletal Muscle Acti: Uniprot: P68133 NCBI: NM_001100 NP_001091.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACTA1 / Skeletal Muscle Actin Polyclonal RW-C468155-100
Antibody: ACTA1 / Skeletal Muscle Actin Rabbit anti-Human Polyclonal (aa50-99) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Drosophila, Insect, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: Skeletal Muscle Actin antibody RW-C468155 is a biotin-conjugated rabbit polyclonal antibody to Skeletal Muscle Actin (ACTA1) (aa50-99) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACTA1 / Skeletal Muscle Actin, Synonym: ACTA1 | ACTA | Actin, alpha skeletal muscle | Alpha-actin-1 | CFTD | CFTD1 | CFTDM | MPFD | NEM1 | NEM2 | ASMA | NEM3, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Drosophila, Insect (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa50-99 of human ACTA1 (P68133, NP_001091). Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Monkey, Mouse, Rat, Sheep, Hamster, Dog, Bovine, Rabbit, Horse, Pig, Guinea pig, Chicken, Xenopus, Salmon, Medaka, Pufferfish, Blood fluke, Drosophila, Mosquito, Slime mold, Nematode, Amoeba (100%)., Epitop: aa50-99, Specificit: Human ACTA1 / ASMA, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTA1 / Skeletal Muscle Acti: Uniprot: P68133 NCBI: NM_001100 NP_001091.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACP5 / TRAP Polyclonal RW-C442246-100
Antibody: ACP5 / TRAP Rabbit anti-Human Polyclonal (aa71-120) (HRP) Antibody, Application: WB, Reactivity: Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: TRAP antibody RW-C442246 is an HRP-conjugated rabbit polyclonal antibody to TRAP (ACP5) (aa71-120) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACP5 / TRAP, Synonym: ACP5 | SPENCDI | TrATPase | Type 5 acid phosphatase | Tartrate-resistant acid ATPase | TR-AP | TRACP5b, Hos: Rabbit, Reactivit: Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa71-120 of human ACP5 (P13686, NP_001602). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Opossum, Platypus (100%); Rabbit, Guinea pig, Lizard, Xenopus, Zebrafish (92%); Salmon, Sablefish, Stickleback, Pufferfish (85%); Pike (84%)., Epitop: aa71-120, Specificit: Human ACP5, Application: Western blot
Applications tested for the base form of this product only, Failed Application: IHC - Paraffin, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACP5 / TRA: Uniprot: P13686 NCBI: NM_001611 NP_001602.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACP5 / TRAP Polyclonal RW-C442243-100
Antibody: ACP5 / TRAP Rabbit anti-Human Polyclonal (aa71-120) (Biotin) Antibody, Application: WB, Reactivity: Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: TRAP antibody RW-C442243 is a biotin-conjugated rabbit polyclonal antibody to TRAP (ACP5) (aa71-120) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACP5 / TRAP, Synonym: ACP5 | SPENCDI | TrATPase | Type 5 acid phosphatase | Tartrate-resistant acid ATPase | TR-AP | TRACP5b, Hos: Rabbit, Reactivit: Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa71-120 of human ACP5 (P13686, NP_001602). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Opossum, Platypus (100%); Rabbit, Guinea pig, Lizard, Xenopus, Zebrafish (92%); Salmon, Sablefish, Stickleback, Pufferfish (85%); Pike (84%)., Epitop: aa71-120, Specificit: Human ACP5, Application: Western blot
Applications tested for the base form of this product only, Failed Application: IHC - Paraffin, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACP5 / TRA: Uniprot: P13686 NCBI: NM_001611 NP_001602.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACP5 / TRAP Polyclonal RW-C442244-100
Antibody: ACP5 / TRAP Rabbit anti-Human Polyclonal (aa71-120) (FITC) Antibody, Application: WB, Reactivity: Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: TRAP antibody RW-C442244 is an FITC-conjugated rabbit polyclonal antibody to TRAP (ACP5) (aa71-120) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACP5 / TRAP, Synonym: ACP5 | SPENCDI | TrATPase | Type 5 acid phosphatase | Tartrate-resistant acid ATPase | TR-AP | TRACP5b, Hos: Rabbit, Reactivit: Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa71-120 of human ACP5 (P13686, NP_001602). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Opossum, Platypus (100%); Rabbit, Guinea pig, Lizard, Xenopus, Zebrafish (92%); Salmon, Sablefish, Stickleback, Pufferfish (85%); Pike (84%)., Epitop: aa71-120, Specificit: Human ACP5, Application: Western blot
Applications tested for the base form of this product only, Failed Application: IHC - Paraffin, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACP5 / TRA: Uniprot: P13686 NCBI: NM_001611 NP_001602.1
469.00 € 469.0 EUR
Mouse anti‑Human ACLY / ATP Citrate Lyase Monoclonal RW-C812885-50
Antibody: ACLY / ATP Citrate Lyase Mouse anti-Human Monoclonal Antibody, Application: IF, WB, Flo, Reactivity: Human, Mouse, Rat, Bovine, Pig, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: ATP Citrate Lyase antibody RW-C812885 is an unconjugated mouse monoclonal antibody to ATP Citrate Lyase (ACLY) from human. It is reactive with human, mouse, rat and other species. Validated for Flow, IF and WB., Targe: Human ACLY / ATP Citrate Lyase, Synonym: ACLY | ACL | ATP citrate synthase | ATPCL | ATP citrate lyase | ATP-citrate (pro-S-)-lyase | CLATP | ATP-citrate synthase | Citrate cleavage enzyme | Citrate Lyase, Hos: Mouse, Reactivit: Human, Mouse, Rat, Bovine, Pig, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Monoclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: Purified recombinant human ATP-citrate synthase (C-Terminus) protein fragments expressed in E.coli., Specificit: ATP-citrate synthase Monoclonal Antibody detects endogenous levels of ATP-citrate synthase protein., Application: Immunofluorescence (1:100 - 1:500)
Western blot (1:1000 - 1:2000)
Flow Cytometry (1:100 - 1:200), Usag: Applications should be user optimized., Presentatio: 0.1 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.2% sodium azide, 50% glycerol., Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACLY / ATP Citrate Lyas: Uniprot: P53396 NCBI: NM_001096 NP_001087.2
505.00 € 505.0 EUR
Rabbit anti‑Human ACVR2 / ACVR2A Polyclonal RW-C447379-100
Antibody: ACVR2 / ACVR2A Rabbit anti-Human Polyclonal (C-Terminus) (HRP) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ACVR2A antibody RW-C447379 is an HRP-conjugated rabbit polyclonal antibody to ACVR2A (ACVR2) (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACVR2 / ACVR2A, Synonym: ACVR2A | ACTRIIA | Activin receptor type IIA | ACTRII | Activin A receptor type II | Activin receptor type-2A | ACTR-IIA | Activin A receptor, type II | Activin A receptor, type IIA | ACVR2, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide directed towards the C-Terminus of Human AVR2A. Percent identity by BLAST analysis: Dog, Pig, Rat, Goat, Horse, Human, Mouse, Sheep, Bovine, Rabbit, Guinea pig (100%); Zebrafish (93%)., Epitop: C-Terminus, Specificit: Human ACVR2 / ACVR2A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACVR2 / ACVR2: Uniprot: P27037 NCBI: NM_001616 NP_001607.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACVR2 / ACVR2A Polyclonal RW-C447377-100
Antibody: ACVR2 / ACVR2A Rabbit anti-Human Polyclonal (C-Terminus) (FITC) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ACVR2A antibody RW-C447377 is an FITC-conjugated rabbit polyclonal antibody to ACVR2A (ACVR2) (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACVR2 / ACVR2A, Synonym: ACVR2A | ACTRIIA | Activin receptor type IIA | ACTRII | Activin A receptor type II | Activin receptor type-2A | ACTR-IIA | Activin A receptor, type II | Activin A receptor, type IIA | ACVR2, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide directed towards the C-Terminus of Human AVR2A. Percent identity by BLAST analysis: Dog, Pig, Rat, Goat, Horse, Human, Mouse, Sheep, Bovine, Rabbit, Guinea pig (100%); Zebrafish (93%)., Epitop: C-Terminus, Specificit: Human ACVR2 / ACVR2A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACVR2 / ACVR2: Uniprot: P27037 NCBI: NM_001616 NP_001607.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACVR2 / ACVR2A Polyclonal RW-C447376-100
Antibody: ACVR2 / ACVR2A Rabbit anti-Human Polyclonal (C-Terminus) (Biotin) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ACVR2A antibody RW-C447376 is a biotin-conjugated rabbit polyclonal antibody to ACVR2A (ACVR2) (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ACVR2 / ACVR2A, Synonym: ACVR2A | ACTRIIA | Activin receptor type IIA | ACTRII | Activin A receptor type II | Activin receptor type-2A | ACTR-IIA | Activin A receptor, type II | Activin A receptor, type IIA | ACVR2, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide directed towards the C-Terminus of Human AVR2A. Percent identity by BLAST analysis: Dog, Pig, Rat, Goat, Horse, Human, Mouse, Sheep, Bovine, Rabbit, Guinea pig (100%); Zebrafish (93%)., Epitop: C-Terminus, Specificit: Human ACVR2 / ACVR2A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACVR2 / ACVR2: Uniprot: P27037 NCBI: NM_001616 NP_001607.1
469.00 € 469.0 EUR
Rabbit anti‑Human ACTRIIB / ACVR2B Polyclonal RW-C447314-100
Antibody: ACTRIIB / ACVR2B Rabbit anti-Human Polyclonal (aa323-372) (FITC) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish, Format: FITC, Unmodified, Other formats: Biotin HRP Unconjugated, Descriptio: ACVR2B antibody RW-C447314 is an FITC-conjugated rabbit polyclonal antibody to ACVR2B (ACTRIIB) (aa323-372) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTRIIB / ACVR2B, Synonym: ACVR2B | Activin A receptor type IIB | Activin receptor type-2B | ActR-IIB | ACTRIIB | Activin receptor type IIB | Activin A receptor, type IIB | HTX4, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa323-372 of human ACVR2B (Q13705, NP_001097). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig, Turkey, Chicken, Xenopus, Trout, Zebrafish (100%); Goat, Drosophila (84%)., Epitop: aa323-372, Specificit: Human ACVR2B, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTRIIB / ACVR2: Uniprot: Q13705 NCBI: NM_001106 NP_001097.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACTRIIB / ACVR2B IgG Polyclonal RW-C447318-100
Antibody: ACTRIIB / ACVR2B Rabbit anti-Human Polyclonal (C-Terminus) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ACVR2B antibody RW-C447318 is an HRP-conjugated rabbit polyclonal antibody to ACVR2B (ACTRIIB) (C-Terminus) from human. It is reactive with human, bat, bovine and other species. Validated for WB., Targe: Human ACTRIIB / ACVR2B, Synonym: ACVR2B | Activin A receptor type IIB | Activin receptor type-2B | ActR-IIB | ACTRIIB | Activin receptor type IIB | Activin A receptor, type IIB | HTX4, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ACVR2B (Q4VAU9). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig, Turkey, Chicken, Xenopus, Trout (100%); Mouse, Rat, Platypus, Medaka, Zebrafish (92%); Marmoset, Stickleback (85%)., Epitop: C-Terminus, Specificit: Human ACVR2B, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTRIIB / ACVR2: Uniprot: Q13705 NCBI: NM_001106 NP_001097.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACTRIIB / ACVR2B Polyclonal RW-C447313-100
Antibody: ACTRIIB / ACVR2B Rabbit anti-Human Polyclonal (aa323-372) (Biotin) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish, Format: Biotin, Unmodified, Other formats: FITC HRP Unconjugated, Descriptio: ACVR2B antibody RW-C447313 is a biotin-conjugated rabbit polyclonal antibody to ACVR2B (ACTRIIB) (aa323-372) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTRIIB / ACVR2B, Synonym: ACVR2B | Activin A receptor type IIB | Activin receptor type-2B | ActR-IIB | ACTRIIB | Activin receptor type IIB | Activin A receptor, type IIB | HTX4, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa323-372 of human ACVR2B (Q13705, NP_001097). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig, Turkey, Chicken, Xenopus, Trout, Zebrafish (100%); Goat, Drosophila (84%)., Epitop: aa323-372, Specificit: Human ACVR2B, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTRIIB / ACVR2: Uniprot: Q13705 NCBI: NM_001106 NP_001097.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACTRIIB / ACVR2B IgG Polyclonal RW-C447317-100
Antibody: ACTRIIB / ACVR2B Rabbit anti-Human Polyclonal (C-Terminus) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ACVR2B antibody RW-C447317 is an FITC-conjugated rabbit polyclonal antibody to ACVR2B (ACTRIIB) (C-Terminus) from human. It is reactive with human, bat, bovine and other species. Validated for WB., Targe: Human ACTRIIB / ACVR2B, Synonym: ACVR2B | Activin A receptor type IIB | Activin receptor type-2B | ActR-IIB | ACTRIIB | Activin receptor type IIB | Activin A receptor, type IIB | HTX4, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ACVR2B (Q4VAU9). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig, Turkey, Chicken, Xenopus, Trout (100%); Mouse, Rat, Platypus, Medaka, Zebrafish (92%); Marmoset, Stickleback (85%)., Epitop: C-Terminus, Specificit: Human ACVR2B, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTRIIB / ACVR2: Uniprot: Q13705 NCBI: NM_001106 NP_001097.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACTRIIB / ACVR2B IgG Polyclonal RW-C447316-100
Antibody: ACTRIIB / ACVR2B Rabbit anti-Human Polyclonal (C-Terminus) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ACVR2B antibody RW-C447316 is a biotin-conjugated rabbit polyclonal antibody to ACVR2B (ACTRIIB) (C-Terminus) from human. It is reactive with human, bat, bovine and other species. Validated for WB., Targe: Human ACTRIIB / ACVR2B, Synonym: ACVR2B | Activin A receptor type IIB | Activin receptor type-2B | ActR-IIB | ACTRIIB | Activin receptor type IIB | Activin A receptor, type IIB | HTX4, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ACVR2B (Q4VAU9). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig, Turkey, Chicken, Xenopus, Trout (100%); Mouse, Rat, Platypus, Medaka, Zebrafish (92%); Marmoset, Stickleback (85%)., Epitop: C-Terminus, Specificit: Human ACVR2B, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTRIIB / ACVR2: Uniprot: Q13705 NCBI: NM_001106 NP_001097.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACTRIIB / ACVR2B Polyclonal RW-C447311-100
Antibody: ACTRIIB / ACVR2B Rabbit anti-Human Polyclonal (aa287-336) (FITC) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Zebrafish, Format: FITC, Unmodified, Other formats: Biotin HRP Unconjugated, Descriptio: ACVR2B antibody RW-C447311 is an FITC-conjugated rabbit polyclonal antibody to ACVR2B (ACTRIIB) (aa287-336) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTRIIB / ACVR2B, Synonym: ACVR2B | Activin A receptor type IIB | Activin receptor type-2B | ActR-IIB | ACTRIIB | Activin receptor type IIB | Activin A receptor, type IIB | HTX4, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa287-336 of human ACVR2B (Q13705, NP_001097). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Guinea pig (100%); Opossum, Turkey, Chicken, Xenopus, Drosophila (92%); Orangutan, Beetle (90%); Trout, Stickleback, Zebrafish (85%)., Epitop: aa287-336, Specificit: Human ACVR2B, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTRIIB / ACVR2: Uniprot: Q13705 NCBI: NM_001106 NP_001097.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACTRIIB / ACVR2B Polyclonal RW-C447312-100
Antibody: ACTRIIB / ACVR2B Rabbit anti-Human Polyclonal (aa287-336) (HRP) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Biotin FITC Unconjugated, Descriptio: ACVR2B antibody RW-C447312 is an HRP-conjugated rabbit polyclonal antibody to ACVR2B (ACTRIIB) (aa287-336) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTRIIB / ACVR2B, Synonym: ACVR2B | Activin A receptor type IIB | Activin receptor type-2B | ActR-IIB | ACTRIIB | Activin receptor type IIB | Activin A receptor, type IIB | HTX4, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa287-336 of human ACVR2B (Q13705, NP_001097). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Guinea pig (100%); Opossum, Turkey, Chicken, Xenopus, Drosophila (92%); Orangutan, Beetle (90%); Trout, Stickleback, Zebrafish (85%)., Epitop: aa287-336, Specificit: Human ACVR2B, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTRIIB / ACVR2: Uniprot: Q13705 NCBI: NM_001106 NP_001097.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACTRIIB / ACVR2B Polyclonal RW-C447310-100
Antibody: ACTRIIB / ACVR2B Rabbit anti-Human Polyclonal (aa287-336) (Biotin) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Zebrafish, Format: Biotin, Unmodified, Other formats: FITC HRP Unconjugated, Descriptio: ACVR2B antibody RW-C447310 is a biotin-conjugated rabbit polyclonal antibody to ACVR2B (ACTRIIB) (aa287-336) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTRIIB / ACVR2B, Synonym: ACVR2B | Activin A receptor type IIB | Activin receptor type-2B | ActR-IIB | ACTRIIB | Activin receptor type IIB | Activin A receptor, type IIB | HTX4, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa287-336 of human ACVR2B (Q13705, NP_001097). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Guinea pig (100%); Opossum, Turkey, Chicken, Xenopus, Drosophila (92%); Orangutan, Beetle (90%); Trout, Stickleback, Zebrafish (85%)., Epitop: aa287-336, Specificit: Human ACVR2B, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTRIIB / ACVR2: Uniprot: Q13705 NCBI: NM_001106 NP_001097.2
469.00 € 469.0 EUR
Rabbit anti‑Human ACTRIIB / ACVR2B Polyclonal RW-C447315-100
Antibody: ACTRIIB / ACVR2B Rabbit anti-Human Polyclonal (aa323-372) (HRP) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Biotin FITC Unconjugated, Descriptio: ACVR2B antibody RW-C447315 is an HRP-conjugated rabbit polyclonal antibody to ACVR2B (ACTRIIB) (aa323-372) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTRIIB / ACVR2B, Synonym: ACVR2B | Activin A receptor type IIB | Activin receptor type-2B | ActR-IIB | ACTRIIB | Activin receptor type IIB | Activin A receptor, type IIB | HTX4, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa323-372 of human ACVR2B (Q13705, NP_001097). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig, Turkey, Chicken, Xenopus, Trout, Zebrafish (100%); Goat, Drosophila (84%)., Epitop: aa323-372, Specificit: Human ACVR2B, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTRIIB / ACVR2: Uniprot: Q13705 NCBI: NM_001106 NP_001097.2
469.00 € 469.0 EUR
Mouse anti‑Rabbit ACTN2 IgM Monoclonal RW-C95373-0.1
Antibody: ACTN2 Mouse anti-Rabbit Monoclonal (5C5) Antibody, Application: IHC, Reactivity: Rabbit, Human, Rat, Bovine, Guinea pig, Pig, Sheep, Frog, Format: Unconjugated, Unmodified, Descriptio: ACTN2 antibody RW-C95373 is an unconjugated mouse monoclonal antibody to ACTN2 from rabbit. It is reactive with human, rat, bovine and other species. Validated for IHC., Targe: Rabbit ACTN2, Synonym: ACTN2 | Actinin, alpha 2 | Alpha-actinin skeletal muscle | CMD1AA | F-actin cross-linking protein | Alpha-actinin-2, Hos: Mouse, Reactivit: Rabbit, Human, Rat, Bovine, Guinea pig, Pig, Sheep, Frog (tested or 100% immunogen sequence identity), Clonalit: IgM Monoclonal, Clon: 5C5, Conjugation: Unconjugated, Purificatio: Ascites, Modification: Unmodified, Immunoge: BALB/C mice were injected with purified rabbit striated muscle actin., Specificit: Monoclonal anti-alpha-sarcomeric Actin has been used as a marker for rhabdomyosarcoma. is specific to alpha-skeletal and alpha-cardiac muscle actins. It cross reacts with human, sheep, bovine, rabbit, guinea pig, rat, frog, snake and carp. It does not react with smooth muscle tissue., Application: IHC, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: 0.05% Sodium Azide, Storag: Store at 2°C to 8°C. Do not freeze., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTN: Uniprot: P35609 NCBI: NM_001103 NP_001094.1
602.00 € 602.0 EUR
Goat anti‑Human ACTN1 Polyclonal RW-C305859-100
Antibody: ACTN1 Goat anti-Human Polyclonal (aa596-609) Antibody, Application: WB, Peptide-ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: ACTN1 antibody RW-C305859 is an unconjugated goat polyclonal antibody to ACTN1 (aa596-609) from human. It is reactive with human, mouse, rat and other species. Validated for Peptide-ELISA and WB., Targe: Human ACTN1, Synonym: ACTN1 | Alpha-actinin-1 | Actinin 1 smooth muscle | Actinin, alpha 1 | F-actin cross-linking protein | Non-muscle alpha-actinin-1 | ASMA, Hos: Goat, Reactivit: Human, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide., Modification: Unmodified, Immunoge: Peptide with sequence C-TPQEINGKWDHVRQ, from the internal region of the protein sequence according to NP_001123476.1NP_001093.1NP_001123477.1., Epitop: aa596-609, Specificit: Human ACTN1. This antibody is expected to recognize all reported isoforms (NP_001123476.1; NP_001093.1; NP_001123477.1)., Application: Western blot (0.3 - 1 µg/ml)
Peptide Enzyme-Linked Immunosorbent Assay (1:128000), Usag: Peptide ELISA: antibody detection limit dilution 1:128000. Western blot: Approx 100kD band observed in Human Spleen lysates (calculated MW of 103kD according to NP_001093.1). Recommended concentration: 0.3-1 ug/ml. An additional band of unknown identity was also consistently observed at 75kD. This band was successfully blocked by incubation with the immunizing peptide., Presentatio: TBS, pH 7.3, 0.02% Sodium Azide, 0.5% BSA, Storag: Aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTN: Uniprot: P12814 NCBI: NM_001102 NP_001093.1
503.00 € 503.0 EUR
Rabbit anti‑Human ACTG1 / Gamma Actin Polyclonal RW-C351786-100
Antibody: ACTG1 / Gamma Actin Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Gamma Actin antibody RW-C351786 is an unconjugated rabbit polyclonal antibody to Gamma Actin (ACTG1) (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ACTG1 / Gamma Actin, Synonym: ACTG1 | ACTG | Actin, gamma 1 | BRWS2 | Cytoskeletal gamma-actin | DFNA20 | Actin, cytoplasmic 2 | Gamma-actin | DFNA26, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human Gamma-actin-1., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of Gamma-actin-1 protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACTG1 / Gamma Acti: Uniprot: P63261 NCBI: NM_001614 NP_001605.1
299.00 € 299.0 EUR
Rabbit anti‑Human ADCYAP1R1 / PAC1 Receptor Polyclonal RW-C466920-100
Antibody: ADCYAP1R1 / PAC1 Receptor Rabbit anti-Human Polyclonal (aa343-392) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: PAC1 Receptor antibody RW-C466920 is an HRP-conjugated rabbit polyclonal antibody to PAC1 Receptor (ADCYAP1R1) (aa343-392) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADCYAP1R1 / PAC1 Receptor, Synonym: ADCYAP1R1 | PAC1 | Pac1 receptor | Pac1 receptors | PAC1-R | PACAP receptor 1 | Pacap specific receptor | PACAP-R-1 | PACAP/VIP receptors | PACAP1 receptor | PACAP Receptor | Pacap receptor type 1 | Pacap type 1 receptor | PACAP type I receptor | PACAPR | PAC1R | PACAP-R1 | PACAPRI | Pvr1 | Pacap receptor type i, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa343-392 of human ADCYAP1R1 (P41586, NP_001109). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Rabbit, Horse, Pig, Guinea pig, Zebra finch, Chicken, Xenopus, Pufferfish (100%); Bat, Lizard, Trout (92%); Zebrafish (85%)., Epitop: aa343-392, Specificit: Human ADCYAP1R1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADCYAP1R1 / PAC1 Recepto: Uniprot: P41586 NCBI: NM_001118 NP_001109.2
469.00 € 469.0 EUR
Rabbit anti‑Human ADCYAP1R1 / PAC1 Receptor Polyclonal RW-C466918-100
Antibody: ADCYAP1R1 / PAC1 Receptor Rabbit anti-Human Polyclonal (aa343-392) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: PAC1 Receptor antibody RW-C466918 is a biotin-conjugated rabbit polyclonal antibody to PAC1 Receptor (ADCYAP1R1) (aa343-392) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADCYAP1R1 / PAC1 Receptor, Synonym: ADCYAP1R1 | PAC1 | Pac1 receptor | Pac1 receptors | PAC1-R | PACAP receptor 1 | Pacap specific receptor | PACAP-R-1 | PACAP/VIP receptors | PACAP1 receptor | PACAP Receptor | Pacap receptor type 1 | Pacap type 1 receptor | PACAP type I receptor | PACAPR | PAC1R | PACAP-R1 | PACAPRI | Pvr1 | Pacap receptor type i, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa343-392 of human ADCYAP1R1 (P41586, NP_001109). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Rabbit, Horse, Pig, Guinea pig, Zebra finch, Chicken, Xenopus, Pufferfish (100%); Bat, Lizard, Trout (92%); Zebrafish (85%)., Epitop: aa343-392, Specificit: Human ADCYAP1R1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADCYAP1R1 / PAC1 Recepto: Uniprot: P41586 NCBI: NM_001118 NP_001109.2
469.00 € 469.0 EUR
Rabbit anti‑Human ADCYAP1R1 / PAC1 Receptor Polyclonal RW-C466919-100
Antibody: ADCYAP1R1 / PAC1 Receptor Rabbit anti-Human Polyclonal (aa343-392) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: PAC1 Receptor antibody RW-C466919 is an FITC-conjugated rabbit polyclonal antibody to PAC1 Receptor (ADCYAP1R1) (aa343-392) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADCYAP1R1 / PAC1 Receptor, Synonym: ADCYAP1R1 | PAC1 | Pac1 receptor | Pac1 receptors | PAC1-R | PACAP receptor 1 | Pacap specific receptor | PACAP-R-1 | PACAP/VIP receptors | PACAP1 receptor | PACAP Receptor | Pacap receptor type 1 | Pacap type 1 receptor | PACAP type I receptor | PACAPR | PAC1R | PACAP-R1 | PACAPRI | Pvr1 | Pacap receptor type i, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa343-392 of human ADCYAP1R1 (P41586, NP_001109). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Rabbit, Horse, Pig, Guinea pig, Zebra finch, Chicken, Xenopus, Pufferfish (100%); Bat, Lizard, Trout (92%); Zebrafish (85%)., Epitop: aa343-392, Specificit: Human ADCYAP1R1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADCYAP1R1 / PAC1 Recepto: Uniprot: P41586 NCBI: NM_001118 NP_001109.2
469.00 € 469.0 EUR
Rabbit anti‑Human ADRB2 Polyclonal RW-C351816-100
Antibody: ADRB2 Rabbit anti-Human Polyclonal (pSer346) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Sheep, Format: Unconjugated, Unmodified, Descriptio: ADRB2 antibody RW-C351816 is an unconjugated rabbit polyclonal antibody to ADRB2 (pSer346) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADRB2, Synonym: ADRB2 | ADRB2R | Adrenoceptor beta 2, surface | ADRBR | B2AR | Beta-2 adrenoceptor | Beta-2 adrenergic receptor | Beta-2 adrenoreceptor | BETA2AR | BAR | Adrenergic beta-2 receptor | Catecholamine receptor, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human Beta-2 Adrenergic Receptor., Epitop: pSer346, Specificit: Recognizes endogenous levels of Beta-2 Adrenergic Receptor (pS346) protein., Application: Western blot (1:500 - 1:1000), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADRB: Uniprot: P07550 NCBI: NM_000024 NP_000015.1
315.00 € 315.0 EUR
Rabbit anti‑Human ADRB2 Polyclonal RW-C353903-100
Antibody: ADRB2 Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Sheep, Format: Unconjugated, Unmodified, Descriptio: ADRB2 antibody RW-C353903 is an unconjugated rabbit polyclonal antibody to ADRB2 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADRB2, Synonym: ADRB2 | ADRB2R | Adrenoceptor beta 2, surface | ADRBR | B2AR | Beta-2 adrenoceptor | Beta-2 adrenergic receptor | Beta-2 adrenoreceptor | BETA2AR | BAR | Adrenergic beta-2 receptor | Catecholamine receptor, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human Beta-2 Adrenergic Receptor., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of Beta-2 Adrenergic Receptor protein., Application: Western blot (1:500 - 1:1000), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADRB: Uniprot: P07550 NCBI: NM_000024 NP_000015.1
299.00 € 299.0 EUR
Chicken anti‑Human ADRB2 IgY Polyclonal RW-C63768-50
Antibody: ADRB2 Chicken anti-Human Polyclonal (aa335-408) Antibody, Application: WB, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: ADRB2 antibody RW-C63768 is an unconjugated chicken polyclonal antibody to ADRB2 (aa335-408) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADRB2, Synonym: ADRB2 | ADRB2R | Adrenoceptor beta 2, surface | ADRBR | B2AR | Beta-2 adrenoceptor | Beta-2 adrenergic receptor | Beta-2 adrenoreceptor | BETA2AR | BAR | Adrenergic beta-2 receptor | Catecholamine receptor, Hos: Chicken, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgY Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide: DFRIAFQELLC LRRSSLKAYGN GYSSNGNTGE QSGYHVEQEKE NKLLCEDLPGT EDFVGHQGTVP SDNIDSQGRNCS T, corresponding to amino acids 335-408 of Human beta 2 Adrenergic Receptor. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Panda, Bovine, Dog, Cat, Horse, Rabbit, Guinea pig (100%); Porcine, Bat, Chicken, Opossum (91%); Gibbon, Lizard, Xenopus, Stickleback, Pufferfish (82%)., Epitop: aa335-408, Specificit: Recognizes human Beta 2 Andrenergic Receptor at ~46.5kD., Application: Western blot, Usag: Suitable for use in Western Blot., Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, Storag: Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADRB: Uniprot: P07550 NCBI: NM_000024 NP_000015.1
807.00 € 807.0 EUR
Rabbit anti‑Human ADRA2A Polyclonal RW-C313298-10
Antibody: ADRA2A Rabbit anti-Human Polyclonal (aa213-228) Antibody, Application: WB, Reactivity: Human, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: ADRA2A antibody RW-C313298 is an unconjugated rabbit polyclonal antibody to ADRA2A (aa213-228) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADRA2A, Synonym: ADRA2A | Alpha-2A adrenoreceptor | Alpha-2AAR | Alpha-2AAR subtype C10 | ADRA2 | ADRA2R | ADRAR | Adrenoceptor alpha 2A | Alpha 2a | Alpha(2A)-AR | Alpha2a | ALPHA2AAR | Alpha-2A adrenoceptor | Adrenergic alpha 2a receptor | Adrenergic alpha 2a receptor | Alpha-2A adrenergic receptor, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence in the middle region of human alpha 2a Adrenergic Receptor(213-228 aa ILVYVRIYQIAKRRTR), identical to the related mouse and rat sequences., Epitop: aa213-228, Application: Western blot, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Thimerosal, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADRA2: Uniprot: P08913 NCBI: NM_000681 NP_000672.3
470.00 € 470.0 EUR
Rabbit anti‑Human ADRA1A Polyclonal RW-C466955-100
Antibody: ADRA1A Rabbit anti-Human Polyclonal (aa218-267) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ADRA1A antibody RW-C466955 is an FITC-conjugated rabbit polyclonal antibody to ADRA1A (aa218-267) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADRA1A, Synonym: ADRA1A | ADRA1L1 | Adrenergic alpha 1c receptor | Alpha 1c adrenoceptor | Alpha-adrenergic receptor 1c | ADRA1C | Adrenoceptor alpha 1A | Alpha-1A adrenoceptor | Alpha-1A adrenoreceptor | Alpha-1A adrenergic receptor | Alpha-1C adrenergic receptor | ALPHA1AAR | Alpha1C-AR, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa218-267 of human ADRA1A (P35348-8, NP_150647). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Opossum, Guinea pig, Platypus (100%)., Epitop: aa218-267, Specificit: Human ADRA1A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADRA1: Uniprot: P35348 NCBI: NM_000680 BAA04960.1
469.00 € 469.0 EUR
Rabbit anti‑Human ADRA1A Polyclonal RW-C466954-100
Antibody: ADRA1A Rabbit anti-Human Polyclonal (aa218-267) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ADRA1A antibody RW-C466954 is a biotin-conjugated rabbit polyclonal antibody to ADRA1A (aa218-267) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADRA1A, Synonym: ADRA1A | ADRA1L1 | Adrenergic alpha 1c receptor | Alpha 1c adrenoceptor | Alpha-adrenergic receptor 1c | ADRA1C | Adrenoceptor alpha 1A | Alpha-1A adrenoceptor | Alpha-1A adrenoreceptor | Alpha-1A adrenergic receptor | Alpha-1C adrenergic receptor | ALPHA1AAR | Alpha1C-AR, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa218-267 of human ADRA1A (P35348-8, NP_150647). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Opossum, Guinea pig, Platypus (100%)., Epitop: aa218-267, Specificit: Human ADRA1A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADRA1: Uniprot: P35348 NCBI: NM_000680 BAA04960.1
469.00 € 469.0 EUR
Rabbit anti‑Human ADRA1A Polyclonal RW-C466956-100
Antibody: ADRA1A Rabbit anti-Human Polyclonal (aa218-267) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ADRA1A antibody RW-C466956 is an HRP-conjugated rabbit polyclonal antibody to ADRA1A (aa218-267) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ADRA1A, Synonym: ADRA1A | ADRA1L1 | Adrenergic alpha 1c receptor | Alpha 1c adrenoceptor | Alpha-adrenergic receptor 1c | ADRA1C | Adrenoceptor alpha 1A | Alpha-1A adrenoceptor | Alpha-1A adrenoreceptor | Alpha-1A adrenergic receptor | Alpha-1C adrenergic receptor | ALPHA1AAR | Alpha1C-AR, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa218-267 of human ADRA1A (P35348-8, NP_150647). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Opossum, Guinea pig, Platypus (100%)., Epitop: aa218-267, Specificit: Human ADRA1A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADRA1: Uniprot: P35348 NCBI: NM_000680 BAA04960.1
469.00 € 469.0 EUR
Rabbit anti‑Human ADRA1A Polyclonal RW-A1248-50
Antibody: ADRA1A Rabbit anti-Human Polyclonal (Cytoplasmic Domain) Antibody, Application: IHC, IHC-P, ICC, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: Alpha-1-adrenergic receptors (ADRA1A) is a receptor that functions to regulate cellular growth and proliferation and activate various mitogenic responses. In the brain, it may participate in the flight-or-flight response via epinephrine. In immunohistochemistry, ADRA1A has highest membranous and cytoplasmic positivity in the basal ganglia, cerebral cortex and hippocampus in the brain, and is found throughout the central nervous system. It is also highly expressed in the liver, and has low to variable expression in other tissues throughout the body.

References: The UniProt Consortium. Nucleic Acids Res. 47: D506-515 (2019); Nucleic Acids Res. 2016 Jan 4;44(D1):D733-45, PMID:26553804, Targe: Human ADRA1A, Synonym: ADRA1A | ADRA1L1 | Adrenergic alpha 1c receptor | Alpha 1c adrenoceptor | Alpha-adrenergic receptor 1c | ADRA1C | Adrenoceptor alpha 1A | Alpha-1A adrenoceptor | Alpha-1A adrenoreceptor | Alpha-1A adrenergic receptor | Alpha-1C adrenergic receptor | ALPHA1AAR | Alpha1C-AR, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Predicte: Bat, Guinea pig (at least 90% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human ADRA1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Bovine, Dog, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%); Opossum, Platypus (88%)., Epitop: Cytoplasmic Domain, Specificit: Human ADRA1A. BLAST analysis of the peptide immunogen showed no homology with other human proteins., Application: IHC
IHC - Paraffin (3 µg/ml)
ICC, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, 0.1% Sodium Azide, Storag: Aliquot and store undiluted at -20°C or below for up to 1 year. Can be stored undiluted at 4°C for up to 1 month. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADRA1: Uniprot: P35348 NCBI: NM_000680 BAA04960.1
460.00 € 460.0 EUR
Rabbit anti‑Human ADORA3 / Adenosine A3 Receptor Polyclonal RW-C354523-100
Antibody: ADORA3 / Adenosine A3 Receptor Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: WB, Reactivity: Human, Bovine, Dog, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: Adenosine A3 Receptor antibody RW-C354523 is an unconjugated rabbit polyclonal antibody to Adenosine A3 Receptor (ADORA3) (C-Terminus) from human. It is reactive with human, bovine, dog and other species. Validated for WB., Targe: Human ADORA3 / Adenosine A3 Receptor, Synonym: ADORA3 | A3AR | AD026 | Adenosine A3 receptor | BA552M11.5 | A3 adenosine receptor | Adenosine receptor A3 | RP11-552M11.7, Hos: Rabbit, Reactivit: Human, Bovine, Dog, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human Adenosine A3 Receptor., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of Adenosine A3 Receptor protein., Application: Western blot (1:500 - 1:1000), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ADORA3 / Adenosine A3 Recepto: Uniprot: P33765 NCBI: NM_000677 NP_000668.1
299.00 € 299.0 EUR
Rabbit anti‑Human AK1 / Adenylate Kinase 1 Polyclonal RW-C450522-100
Antibody: AK1 / Adenylate Kinase 1 Rabbit anti-Human Polyclonal (aa108-157) (Biotin) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Pig, Rabbit, Sheep, Chicken, Format: Biotin, Unmodified, Other formats: HRP FITC Unconjugated, Descriptio: Adenylate Kinase 1 antibody RW-C450522 is a biotin-conjugated rabbit polyclonal antibody to Adenylate Kinase 1 (AK1) (aa108-157) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AK1 / Adenylate Kinase 1, Synonym: AK1 | Adenylate kinase isoenzyme 1 | Adenylate kinase 1 | AK 1 | ATP-AMP transphosphorylase 1 | Myokinase, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with HRP, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa108-157 of human AK1 (P00568, NP_000467). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Pig, Opossum, Guinea pig, Chicken, Platypus (100%); Horse, Xenopus, Salmon, Smelt, Stickleback (92%); Galago, Catfish, Blood fluke (85%)., Epitop: aa108-157, Specificit: Human AK1, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AK1 / Adenylate Kinase : Uniprot: P00568 NCBI: NM_000476 NP_000467.1
469.00 € 469.0 EUR
Rabbit anti‑Human AK1 / Adenylate Kinase 1 Polyclonal RW-C450775-100
Antibody: AK1 / Adenylate Kinase 1 Rabbit anti-Human Polyclonal (aa108-157) (FITC) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Pig, Rabbit, Sheep, Chicken, Format: FITC, Unmodified, Other formats: HRP Biotin Unconjugated, Descriptio: Adenylate Kinase 1 antibody RW-C450775 is an FITC-conjugated rabbit polyclonal antibody to Adenylate Kinase 1 (AK1) (aa108-157) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AK1 / Adenylate Kinase 1, Synonym: AK1 | Adenylate kinase isoenzyme 1 | Adenylate kinase 1 | AK 1 | ATP-AMP transphosphorylase 1 | Myokinase, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with HRP, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa108-157 of human AK1 (P00568, NP_000467). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Pig, Opossum, Guinea pig, Chicken, Platypus (100%); Horse, Xenopus, Salmon, Smelt, Stickleback (92%); Galago, Catfish, Blood fluke (85%)., Epitop: aa108-157, Specificit: Human AK1, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AK1 / Adenylate Kinase : Uniprot: P00568 NCBI: NM_000476 NP_000467.1
469.00 € 469.0 EUR
Rabbit anti‑Human AK1 / Adenylate Kinase 1 Polyclonal RW-C450123-100
Antibody: AK1 / Adenylate Kinase 1 Rabbit anti-Human Polyclonal (aa108-157) (HRP) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Pig, Rabbit, Sheep, Chicken, Format: Horseradish Peroxidase, Unmodified, Other formats: Biotin FITC Unconjugated, Descriptio: Adenylate Kinase 1 antibody RW-C450123 is an HRP-conjugated rabbit polyclonal antibody to Adenylate Kinase 1 (AK1) (aa108-157) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AK1 / Adenylate Kinase 1, Synonym: AK1 | Adenylate kinase isoenzyme 1 | Adenylate kinase 1 | AK 1 | ATP-AMP transphosphorylase 1 | Myokinase, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa108-157 of human AK1 (P00568, NP_000467). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Pig, Opossum, Guinea pig, Chicken, Platypus (100%); Horse, Xenopus, Salmon, Smelt, Stickleback (92%); Galago, Catfish, Blood fluke (85%)., Epitop: aa108-157, Specificit: Human AK1, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AK1 / Adenylate Kinase : Uniprot: P00568 NCBI: NM_000476 NP_000467.1
469.00 € 469.0 EUR
Rabbit anti‑Human AIMP2 Polyclonal RW-C465992-100
Antibody: AIMP2 Rabbit anti-Human Polyclonal (aa51-100) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: AIMP2 antibody RW-C465992 is an HRP-conjugated rabbit polyclonal antibody to AIMP2 (aa51-100) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AIMP2, Synonym: AIMP2 | JTV1 | JTV-1 | PRO0992 | Protein JTV-1 | p38, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Dog, Guinea pig, Hamster, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa51-100 of human AIMP2 (Q13155, NP_006294). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Dog, Horse, Pig, Guinea pig (100%); Elephant, Bovine, Bat, Rabbit, Xenopus (92%); Opossum, Turkey, Chicken, Platypus (85%)., Epitop: aa51-100, Specificit: Human AIMP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AIMP: Uniprot: Q13155 NCBI: NM_006303 NP_006294.2
469.00 € 469.0 EUR
Rabbit anti‑Human AIMP2 Polyclonal RW-C465990-100
Antibody: AIMP2 Rabbit anti-Human Polyclonal (aa51-100) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: AIMP2 antibody RW-C465990 is a biotin-conjugated rabbit polyclonal antibody to AIMP2 (aa51-100) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AIMP2, Synonym: AIMP2 | JTV1 | JTV-1 | PRO0992 | Protein JTV-1 | p38, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Dog, Guinea pig, Hamster, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa51-100 of human AIMP2 (Q13155, NP_006294). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Dog, Horse, Pig, Guinea pig (100%); Elephant, Bovine, Bat, Rabbit, Xenopus (92%); Opossum, Turkey, Chicken, Platypus (85%)., Epitop: aa51-100, Specificit: Human AIMP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AIMP: Uniprot: Q13155 NCBI: NM_006303 NP_006294.2
469.00 € 469.0 EUR
Rabbit anti‑Human AIMP2 Polyclonal RW-C465991-100
Antibody: AIMP2 Rabbit anti-Human Polyclonal (aa51-100) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Dog, Guinea pig, Hamster, Horse, Pig, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: AIMP2 antibody RW-C465991 is an FITC-conjugated rabbit polyclonal antibody to AIMP2 (aa51-100) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AIMP2, Synonym: AIMP2 | JTV1 | JTV-1 | PRO0992 | Protein JTV-1 | p38, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Dog, Guinea pig, Hamster, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa51-100 of human AIMP2 (Q13155, NP_006294). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Dog, Horse, Pig, Guinea pig (100%); Elephant, Bovine, Bat, Rabbit, Xenopus (92%); Opossum, Turkey, Chicken, Platypus (85%)., Epitop: aa51-100, Specificit: Human AIMP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AIMP: Uniprot: Q13155 NCBI: NM_006303 NP_006294.2
469.00 € 469.0 EUR
Rabbit anti‑Human AIMP2 Polyclonal RW-C759852-100
Antibody: AIMP2 Rabbit anti-Human Polyclonal Antibody, Application: WB, IP, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: AIMP2 antibody RW-C759852 is an unconjugated rabbit polyclonal antibody to AIMP2 from human. It is reactive with human, mouse, rat and other species. Validated for IP and WB., Targe: Human AIMP2, Synonym: AIMP2 | JTV1 | JTV-1 | PRO0992 | Protein JTV-1 | p38, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Immunoge: A 20 amino acid synthetic peptide (aa 341-360) corresponding to human p38., Application: Western blot (1:5000)
Immunoprecipitation (1:250), Usag: Immunoblotting: use at 1:5,000 dilution. A band of ~43 kDa is detected. Immunoprecipitation: use at 1:250 dilution. These are recommended concentrations. User should determine optimal concentrations for their application. Positive control: HeLa cell lysate., Presentatio: Whole antiserum., Storag: One year when stored at -20°C. Avoid multiple freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AIMP: Uniprot: Q13155 NCBI: NM_006303 NP_006294.2
489.00 € 489.0 EUR
Rabbit anti‑Human AIFM1 / AIF / PDCD8 IgG Polyclonal RW-C481016-100
Antibody: AIFM1 / AIF / PDCD8 Rabbit anti-Human Polyclonal (aa81-130) (HRP) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Bovine, Dog, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: PDCD8 antibody RW-C481016 is an HRP-conjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) (aa81-130) from human. It is reactive with human, bovine, chimpanzee and other species. Validated for IHC and WB., Targe: Human AIFM1 / AIF / PDCD8, Synonym: AIFM1 | AIF | COXPD6 | PDCD8 | Programmed cell death 8, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa81-130 of human AIFM1 (O95831-3, NP_665811). Percent identity by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Sheep (100%); Gorilla (93%); Galago, Bovine, Horse (86%); Panda, Dog, Cat, Rabbit (85%); Opossum (83%); Hamster, Elephant, Pig (80%)., Epitop: aa81-130, Specificit: Human AIFM1 / AIF, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AIFM1 / AIF / PDCD: Uniprot: O95831 NCBI: NM_004208 NP_004199.1
469.00 € 469.0 EUR
Rabbit anti‑Human AIFM1 / AIF / PDCD8 IgG Polyclonal RW-C481015-100
Antibody: AIFM1 / AIF / PDCD8 Rabbit anti-Human Polyclonal (aa81-130) (FITC) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Bovine, Dog, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: PDCD8 antibody RW-C481015 is an FITC-conjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) (aa81-130) from human. It is reactive with human, bovine, chimpanzee and other species. Validated for IHC and WB., Targe: Human AIFM1 / AIF / PDCD8, Synonym: AIFM1 | AIF | COXPD6 | PDCD8 | Programmed cell death 8, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa81-130 of human AIFM1 (O95831-3, NP_665811). Percent identity by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Sheep (100%); Gorilla (93%); Galago, Bovine, Horse (86%); Panda, Dog, Cat, Rabbit (85%); Opossum (83%); Hamster, Elephant, Pig (80%)., Epitop: aa81-130, Specificit: Human AIFM1 / AIF, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AIFM1 / AIF / PDCD: Uniprot: O95831 NCBI: NM_004208 NP_004199.1
469.00 € 469.0 EUR
Rabbit anti‑Human AIFM1 / AIF / PDCD8 IgG Polyclonal RW-C481014-100
Antibody: AIFM1 / AIF / PDCD8 Rabbit anti-Human Polyclonal (aa81-130) (Biotin) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Bovine, Dog, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: PDCD8 antibody RW-C481014 is a biotin-conjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) (aa81-130) from human. It is reactive with human, bovine, chimpanzee and other species. Validated for IHC and WB., Targe: Human AIFM1 / AIF / PDCD8, Synonym: AIFM1 | AIF | COXPD6 | PDCD8 | Programmed cell death 8, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa81-130 of human AIFM1 (O95831-3, NP_665811). Percent identity by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Sheep (100%); Gorilla (93%); Galago, Bovine, Horse (86%); Panda, Dog, Cat, Rabbit (85%); Opossum (83%); Hamster, Elephant, Pig (80%)., Epitop: aa81-130, Specificit: Human AIFM1 / AIF, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AIFM1 / AIF / PDCD: Uniprot: O95831 NCBI: NM_004208 NP_004199.1
469.00 € 469.0 EUR
Rabbit anti‑Human AIFM1 / AIF / PDCD8 Polyclonal RW-C353147-100
Antibody: AIFM1 / AIF / PDCD8 Rabbit anti-Human Polyclonal (N-Terminus) Antibody, Application: IHC, IHC-P, ICC, IF, WB, IP, Reactivity: Human, Mouse, Rat, Sheep, Format: Unconjugated, Unmodified, Descriptio: PDCD8 antibody RW-C353147 is an unconjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IF, IHC, IP and WB., Targe: Human AIFM1 / AIF / PDCD8, Synonym: AIFM1 | AIF | COXPD6 | PDCD8 | Programmed cell death 8, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the N-Terminus of human AIFM1., Epitop: N-Terminus, Specificit: Recognizes endogenous levels of AIFM1 protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
ICC (1:100 - 1:500)
Immunofluorescence
Western blot (1:500 - 1:1000)
Immunoprecipitation (1:10 - 1:100), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AIFM1 / AIF / PDCD: Uniprot: O95831 NCBI: NM_004208 NP_004199.1
299.00 € 299.0 EUR
Rabbit anti‑Human AIFM1 / AIF / PDCD8 Polyclonal RW-C313335-10
Antibody: AIFM1 / AIF / PDCD8 Rabbit anti-Human Polyclonal (aa596-613) Antibody, Application: IHC, IHC-P, IHC-Fr, ICC, WB, Reactivity: Human, Monkey, Mouse, Rat, Bat, Bovine, Horse, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: PDCD8 antibody RW-C313335 is an unconjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) (aa596-613) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IHC and WB., Targe: Human AIFM1 / AIF / PDCD8, Synonym: AIFM1 | AIF | COXPD6 | PDCD8 | Programmed cell death 8, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bat, Bovine, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the C-Terminus of human AIF(596-613 aa EQHEDLNEVAKLFNIHED), identical to the related rat and mouse sequences., Epitop: aa596-613, Specificit: Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. ., Application: IHC
IHC - Paraffin
IHC - Frozen
ICC
Western blot, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Thimerosal, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AIFM1 / AIF / PDCD: Uniprot: O95831 NCBI: NM_004208 NP_004199.1
470.00 € 470.0 EUR
Rabbit anti‑Human AHR Polyclonal RW-C312928-10
Antibody: AHR Rabbit anti-Human Polyclonal (aa34-48) Antibody, Application: WB, Reactivity: Human, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Hamster, Pig, Rabbit, Sheep, Xenopus, Format: Unconjugated, Unmodified, Descriptio: AHR antibody RW-C312928 is an unconjugated rabbit polyclonal antibody to AHR (aa34-48) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AHR, Synonym: AHR | Ah receptor | AH-receptor | Aryl hydrocarbon receptor | BHLHe76 | Aromatic hydrocarbon receptor, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Hamster, Pig, Rabbit, Sheep, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the C-Terminus of human AHR (832-848 aa HPSEARPFPDLTSSGFL)., Epitop: aa34-48, Specificit: Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle. ., Application: Western blot, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Thimerosal, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AH: Uniprot: P35869 NCBI: NM_001621 NP_001612.1
470.00 € 470.0 EUR
Rabbit anti‑Human AGTR2 / AT2 Receptor Polyclonal RW-A1322-50
Antibody: AGTR2 / AT2 Receptor Rabbit anti-Human Polyclonal (Internal) Antibody, Application: IHC, IHC-P, Reactivity: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: AT2 Receptor antibody RW-A1322 is an unconjugated rabbit polyclonal antibody to AT2 Receptor (AGTR2) (Internal) from human. It is reactive with human, mouse, rat and other species. Validated for IHC. Tested on 20 paraffin-embedded human tissues., Targe: Human AGTR2 / AT2 Receptor, Synonym: AGTR2 | Angiotensin ii receptor type 2 | Angiotensin II type-2 receptor | AT2 receptor | AT2 | At2r | MRX88 | Angiotensin ii at2 | Angiotensin receptor 2 | Type-2 angiotensin II receptor | ATGR2, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic 16 amino acid peptide from internal region of human AGTR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Pig (100%)., Epitop: Internal, Specificit: Human AGTR2. BLAST analysis of the peptide immunogen showed no homology with other human proteins, except GPR65 (63%), NPFFR2 (44%)., Application: IHC
IHC - Paraffin (10 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Immunohistochemistry: The unconjugated form was validated for use in immunohistochemistry on a panel of 21 formalin-fixed, paraffin-embedded (FFPE) human tissues after proteinase K antigen retrieval. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen. The stained slides were evaluated by a pathologist to confirm staining specificity. The optimal working concentration for the unconjugated form was determined to be 10 ug/ml., Presentatio: PBS, 0.1% Sodium Azide, Storag: Aliquot and store undiluted at -20°C or below for up to 1 year. Can be stored undiluted at 4°C for up to 1 month. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AGTR2 / AT2 Recepto: Uniprot: P50052 NCBI: NM_000686 NP_000677.2
440.00 € 440.0 EUR
Rabbit anti‑Human AGTR1 / AT1 Receptor IgG Polyclonal RW-C443343-100
Antibody: AGTR1 / AT1 Receptor Rabbit anti-Human Polyclonal (aa37-86) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Rabbit, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated FITC Biotin, Descriptio: AT1 Receptor antibody RW-C443343 is an HRP-conjugated rabbit polyclonal antibody to AT1 Receptor (AGTR1) (aa37-86) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AGTR1 / AT1 Receptor, Synonym: AGTR1 | AG2S | AGTR1A | AGTR1B | Angiotensin II type-1 receptor | Ang ii receptor type 1a | Angiotensin receptor 1 | Angiotensin receptor 1a | Angiotensin receptor 1B | AT1R | AT1 receptor | At1a receptor | AT1B | AT1AR | AT2R1 | AT2R1A | AT2R1B | HAT1R | AT1 | At1a | At1b receptor | AT1BR | Type-1 angiotensin II receptor, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with FITC, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa37-86 of human AGTR1 (P30556, NP_004826). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Guinea pig (100%); Galago, Horse, Pig (92%); Opossum (84%)., Epitop: aa37-86, Specificit: Human AGTR1, Application: Western blot
Applications tested for the base form of this product only, Failed Application: IHC - Paraffin, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AGTR1 / AT1 Recepto: Uniprot: P30556 NCBI: NM_000685 NP_000676.1
469.00 € 469.0 EUR
Rabbit anti‑Human AGTR1 / AT1 Receptor IgG Polyclonal RW-C443342-100
Antibody: AGTR1 / AT1 Receptor Rabbit anti-Human Polyclonal (aa37-86) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Rabbit, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: AT1 Receptor antibody RW-C443342 is a biotin-conjugated rabbit polyclonal antibody to AT1 Receptor (AGTR1) (aa37-86) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AGTR1 / AT1 Receptor, Synonym: AGTR1 | AG2S | AGTR1A | AGTR1B | Angiotensin II type-1 receptor | Ang ii receptor type 1a | Angiotensin receptor 1 | Angiotensin receptor 1a | Angiotensin receptor 1B | AT1R | AT1 receptor | At1a receptor | AT1B | AT1AR | AT2R1 | AT2R1A | AT2R1B | HAT1R | AT1 | At1a | At1b receptor | AT1BR | Type-1 angiotensin II receptor, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa37-86 of human AGTR1 (P30556, NP_004826). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Guinea pig (100%); Galago, Horse, Pig (92%); Opossum (84%)., Epitop: aa37-86, Specificit: Human AGTR1, Application: Western blot
Applications tested for the base form of this product only, Failed Application: IHC - Paraffin, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AGTR1 / AT1 Recepto: Uniprot: P30556 NCBI: NM_000685 NP_000676.1
469.00 € 469.0 EUR
Rabbit anti‑Human AGTR1 / AT1 Receptor IgG Polyclonal RW-C443341-100
Antibody: AGTR1 / AT1 Receptor Rabbit anti-Human Polyclonal (aa37-86) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Rabbit, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: AT1 Receptor antibody RW-C443341 is an FITC-conjugated rabbit polyclonal antibody to AT1 Receptor (AGTR1) (aa37-86) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AGTR1 / AT1 Receptor, Synonym: AGTR1 | AG2S | AGTR1A | AGTR1B | Angiotensin II type-1 receptor | Ang ii receptor type 1a | Angiotensin receptor 1 | Angiotensin receptor 1a | Angiotensin receptor 1B | AT1R | AT1 receptor | At1a receptor | AT1B | AT1AR | AT2R1 | AT2R1A | AT2R1B | HAT1R | AT1 | At1a | At1b receptor | AT1BR | Type-1 angiotensin II receptor, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa37-86 of human AGTR1 (P30556, NP_004826). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Guinea pig (100%); Galago, Horse, Pig (92%); Opossum (84%)., Epitop: aa37-86, Specificit: Human AGTR1, Application: Western blot
Applications tested for the base form of this product only, Failed Application: IHC - Paraffin, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AGTR1 / AT1 Recepto: Uniprot: P30556 NCBI: NM_000685 NP_000676.1
469.00 € 469.0 EUR
Rabbit anti‑Rat AGTR1 / AT1 Receptor IgG Polyclonal RW-C11854-100
Antibody: AGTR1 / AT1 Receptor Rabbit anti-Rat Polyclonal (N-Terminus) Antibody, Application: WB, ELISA, Reactivity: Rat, Human, Mouse, Dog, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: AT1 Receptor antibody RW-C11854 is an unconjugated rabbit polyclonal antibody to AT1 Receptor (AGTR1) (N-Terminus) from rat. It is reactive with human, mouse, rat and other species. Validated for ELISA and WB., Targe: Rat AGTR1 / AT1 Receptor, Synonym: AGTR1 | AG2S | AGTR1A | AGTR1B | Angiotensin II type-1 receptor | Ang ii receptor type 1a | Angiotensin receptor 1 | Angiotensin receptor 1a | Angiotensin receptor 1B | AT1R | AT1 receptor | At1a receptor | AT1B | AT1AR | AT2R1 | AT2R1A | AT2R1B | HAT1R | AT1 | At1a | At1b receptor | AT1BR | Type-1 angiotensin II receptor, Hos: Rabbit, Reactivit: Rat, Human, Mouse, Dog, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic 10aa peptide sequence mapping near the N-terminus of rat AT II (KLH coupled). Cellular Localization: Extracellular., Epitop: N-Terminus, Specificit: Recognizes rat Angiotensin II type 1 Receptor. Sequence is the same in all AT II receptor isoforms (Type 1a, 1b and 1c). No sequence homology with other G-protein coupled receptors. Species sequence homology: Mouse, rat, human, porcine, sheep, canine, chimpanzee and rabbit: 100%., Application: Western blot (1 - 10 µg/ml)
ELISA (1:10000 - 1:100000), Usag: Suitable for use in ELISA and Western Blot. Western Blot: 1-10 ug/ml (ECL). Detects ~45kD band. ELISA: 1:10000-1:100000 using 50-100 ng of control peptide/well., Presentatio: PBS, 0.1% BSA, Storag: Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AGTR1 / AT1 Recepto: Uniprot: P30556 NCBI: NM_000685 NP_000676.1
832.00 € 832.0 EUR
Rabbit anti‑Human ALB / Serum Albumin IgG Polyclonal RW-C442677-100
Antibody: ALB / Serum Albumin Rabbit anti-Human Polyclonal (aa540-589) (HRP) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Mouse, Rat, Bovine, Dog, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Biotin FITC Unconjugated, Descriptio: Serum Albumin antibody RW-C442677 is an HRP-conjugated rabbit polyclonal antibody to Serum Albumin (ALB) (aa540-589) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ALB / Serum Albumin, Synonym: ALB | Albumin (32 AA) | Albumin (AA 34) | Albumin | Growth-inhibiting protein 20 | PRO1341 | PRO0883 | Serum albumin | PRO0903, Hos: Rabbit, Reactivit: Human, Chimpanzee, Mouse, Rat, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa540-589 of human ALB (P02768, NP_000468). Percent identity by BLAST analysis: Human, Chimpanzee (100%); Gorilla, Orangutan, Gibbon, Monkey, Galago, Horse (92%); Marmoset, Mouse, Sheep, Elephant, Dog, Cat, Bovine (85%); Platypus (83%); Rat (78%)., Epitop: aa540-589, Specificit: Human ALB / Albumin, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALB / Serum Albumi: Uniprot: P02768 NCBI: NM_000477 NP_000468.1
469.00 € 469.0 EUR
Rabbit anti‑Human ALB / Serum Albumin IgG Polyclonal RW-C442676-100
Antibody: ALB / Serum Albumin Rabbit anti-Human Polyclonal (aa540-589) (FITC) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Mouse, Rat, Bovine, Dog, Sheep, Format: FITC, Unmodified, Other formats: Biotin HRP Unconjugated, Descriptio: Serum Albumin antibody RW-C442676 is an FITC-conjugated rabbit polyclonal antibody to Serum Albumin (ALB) (aa540-589) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ALB / Serum Albumin, Synonym: ALB | Albumin (32 AA) | Albumin (AA 34) | Albumin | Growth-inhibiting protein 20 | PRO1341 | PRO0883 | Serum albumin | PRO0903, Hos: Rabbit, Reactivit: Human, Chimpanzee, Mouse, Rat, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa540-589 of human ALB (P02768, NP_000468). Percent identity by BLAST analysis: Human, Chimpanzee (100%); Gorilla, Orangutan, Gibbon, Monkey, Galago, Horse (92%); Marmoset, Mouse, Sheep, Elephant, Dog, Cat, Bovine (85%); Platypus (83%); Rat (78%)., Epitop: aa540-589, Specificit: Human ALB / Albumin, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALB / Serum Albumi: Uniprot: P02768 NCBI: NM_000477 NP_000468.1
469.00 € 469.0 EUR
Rabbit anti‑Human ALB / Serum Albumin IgG Polyclonal RW-C442675-100
Antibody: ALB / Serum Albumin Rabbit anti-Human Polyclonal (aa540-589) (Biotin) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Mouse, Rat, Bovine, Dog, Sheep, Format: Biotin, Unmodified, Other formats: FITC HRP Unconjugated, Descriptio: Serum Albumin antibody RW-C442675 is a biotin-conjugated rabbit polyclonal antibody to Serum Albumin (ALB) (aa540-589) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ALB / Serum Albumin, Synonym: ALB | Albumin (32 AA) | Albumin (AA 34) | Albumin | Growth-inhibiting protein 20 | PRO1341 | PRO0883 | Serum albumin | PRO0903, Hos: Rabbit, Reactivit: Human, Chimpanzee, Mouse, Rat, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa540-589 of human ALB (P02768, NP_000468). Percent identity by BLAST analysis: Human, Chimpanzee (100%); Gorilla, Orangutan, Gibbon, Monkey, Galago, Horse (92%); Marmoset, Mouse, Sheep, Elephant, Dog, Cat, Bovine (85%); Platypus (83%); Rat (78%)., Epitop: aa540-589, Specificit: Human ALB / Albumin, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALB / Serum Albumi: Uniprot: P02768 NCBI: NM_000477 NP_000468.1
469.00 € 469.0 EUR
Goat anti‑Rat ALB / Serum Albumin IgG Polyclonal RW-C184934-1
Antibody: ALB / Serum Albumin Goat anti-Rat Polyclonal (FITC) Antibody, Application: ELISA, IE, Reactivity: Rat, Human, Monkey, Mouse, Dog, Goat, Guinea pig, Horse, Pig, Sheep, Chicken, Format: FITC, Unmodified, Descriptio: Serum Albumin antibody RW-C184934 is an FITC-conjugated goat polyclonal antibody to Serum Albumin (ALB) from rat. It is reactive with human, mouse, rat and other species. Validated for ELISA and IE., Targe: Rat ALB / Serum Albumin, Synonym: ALB | Albumin (32 AA) | Albumin (AA 34) | Albumin | Growth-inhibiting protein 20 | PRO1341 | PRO0883 | Serum albumin | PRO0903, Hos: Goat, Reactivit: Rat, Human, Monkey, Mouse, Dog, Goat, Guinea pig, Horse, Pig, Sheep, Chicken (tested or 100% immunogen sequence identity), Non-Reactivit: Bovine, Goat, Sheep, Chicken, Clonalit: IgG Polyclonal, Conjugation: FITC, Purificatio: Ion exchange chromatography, Modification: Unmodified, Immunoge: Highly purified albumin isolated from rat serum, Specificit: Rat Albumin serum. In immunoelectrophoresis and double radial immunodiffusion (Ouchterlony) against appropriate concentrations of the immunogen, a single characteristic precipitin line is obtained which shows a reaction of identity with the precipitin lines obtained against rat serum and the purified albumin., Application: ELISA
Immunoelectrophoresis, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: Lyophilized from PBS, pH 7.0, Reconstitutio: 1 ml Sterile distilled water, Storag: Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALB / Serum Albumi: Uniprot: P02768 NCBI: NM_000477 NP_000468.1
568.00 € 568.0 EUR
Rabbit anti‑Bovine ALB / Serum Albumin IgG Polyclonal RW-C191508-1
Antibody: ALB / Serum Albumin Rabbit anti-Bovine Polyclonal (HRP) Antibody, Application: IHC, ICC, ELISA, IE, Reactivity: Bovine, Human, Monkey, Mouse, Rat, Cat, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Sheep, Format: Horseradish Peroxidase, Unmodified, Descriptio: Serum Albumin antibody RW-C191508 is an HRP-conjugated rabbit polyclonal antibody to Serum Albumin (ALB) from bovine. It is reactive with human, mouse, rat and other species. Validated for ELISA, ICC, IE and IHC., Targe: Bovine ALB / Serum Albumin, Synonym: ALB | Albumin (32 AA) | Albumin (AA 34) | Albumin | Growth-inhibiting protein 20 | PRO1341 | PRO0883 | Serum albumin | PRO0903, Hos: Rabbit, Reactivit: Bovine, Human, Monkey, Mouse, Rat, Cat, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Non-Reactivit: Rabbit, Chicken, Duck, Pigeon, Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase, Purificatio: Ion exchange chromatography, Modification: Unmodified, Immunoge: Purified albumin isolated from pooled bovine serum., Specificit: Bovine Albumin. Species cross-reactivity: feline, goat, human, guinea pig, monkey, rat, canine, hamster, mouse, sheep, equine and porcine. Does not cross-react with rabbit, chicken, duck or pigeon, Application: IHC
ICC
ELISA
Immunoelectrophoresis, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: Lyophilized from PBS, pH 7.2, No preservatives added, Reconstitutio: 1 ml Sterile distilled water, Storag: Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALB / Serum Albumi: Uniprot: P02768 NCBI: NM_000477 NP_000468.1
568.00 € 568.0 EUR
Rabbit anti‑Bovine ALB / Serum Albumin IgG Polyclonal RW-C191506-1
Antibody: ALB / Serum Albumin Rabbit anti-Bovine Polyclonal (Biotin) Antibody, Application: IHC, ICC, ELISA, ID, IE, Reactivity: Bovine, Human, Monkey, Rat, Dog, Goat, Guinea pig, Horse, Pig, Sheep, Format: Biotin, Unmodified, Descriptio: Serum Albumin antibody RW-C191506 is a biotin-conjugated rabbit polyclonal antibody to Serum Albumin (ALB) from bovine. It is reactive with human, rat, bovine and other species. Validated for ELISA, ICC, ID, IE and IHC., Targe: Bovine ALB / Serum Albumin, Synonym: ALB | Albumin (32 AA) | Albumin (AA 34) | Albumin | Growth-inhibiting protein 20 | PRO1341 | PRO0883 | Serum albumin | PRO0903, Hos: Rabbit, Reactivit: Bovine, Human, Monkey, Rat, Dog, Goat, Guinea pig, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Non-Reactivit: Mouse, Rabbit, Chicken, Clonalit: IgG Polyclonal, Conjugation: Biotin, Purificatio: Purified, Modification: Unmodified, Immunoge: Purified albumin isolated from pooled bovine serum., Specificit: Bovine Albumiun. Species Crossreactivity: canine, goat, guinea pig, equine, human, monkey, rat, sheep, porcine. Does not react with chicken, mouse and rabbit., Application: IHC
ICC
ELISA
Immunodiffusion
Immunoelectrophoresis, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: Lyophilized from PBS, pH 7.2, Reconstitutio: Reconstitute with 1.0 ml sterile ddH2O, Storag: Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALB / Serum Albumi: Uniprot: P02768 NCBI: NM_000477 NP_000468.1
568.00 € 568.0 EUR
Rabbit anti‑Bovine ALB / Serum Albumin IgG Polyclonal RW-C191505-5
Antibody: ALB / Serum Albumin Rabbit anti-Bovine Polyclonal Antibody, Application: WB, ELISA, Reactivity: Bovine, Human, Monkey, Mouse, Rat, Cat, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: Serum Albumin antibody RW-C191505 is an unconjugated rabbit polyclonal antibody to Serum Albumin (ALB) from bovine. It is reactive with human, mouse, rat and other species. Validated for ELISA and WB., Targe: Bovine ALB / Serum Albumin, Synonym: ALB | Albumin (32 AA) | Albumin (AA 34) | Albumin | Growth-inhibiting protein 20 | PRO1341 | PRO0883 | Serum albumin | PRO0903, Hos: Rabbit, Reactivit: Bovine, Human, Monkey, Mouse, Rat, Cat, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Purified, Modification: Unmodified, Immunoge: Highly purified albumin isolated from bovine serum., Specificit: Bovine Albumin. Species crossreactivity: feline, canine, goat, guinea pig, hamster, equine, human, monkey, mouse, rat, sheeo, porcine. Does not react with chicken, duck, pigeon or rabbit., Application: Western blot
ELISA, Presentatio: Lyophilized from PBS, pH 7.2, Reconstitutio: Reconstitute in 500ul sterile ddH2O., Storag: Lyophilized and resuspended forms: store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALB / Serum Albumi: Uniprot: P02768 NCBI: NM_000477 NP_000468.1
570.00 € 570.0 EUR
Rabbit anti‑Human AKT2 Polyclonal RW-C425845-100
Antibody: AKT2 Rabbit anti-Human Polyclonal (C-Terminus) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: AKT2 antibody RW-C425845 is a biotin-conjugated rabbit polyclonal antibody to AKT2 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AKT2, Synonym: AKT2 | PKB beta | PKBBETA | PRKBB | Protein kinase Akt-2 | Protein kinase B beta | RAC-PK-beta | Rac protein kinase beta | RAC-BETA | HIHGHH | PKBB, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human AKT2 (P31751, NP_001617). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Baboon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Dog, Bovine, Bat, Goat, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus, Salmon, Zebrafish, Stickleback (100%)., Epitop: C-Terminus, Specificit: Human AKT2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31751 NCBI: NM_001626 NP_001617.1
469.00 € 469.0 EUR
Rabbit anti‑Human AKT2 Polyclonal RW-C425846-100
Antibody: AKT2 Rabbit anti-Human Polyclonal (C-Terminus) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated FITC Biotin, Descriptio: AKT2 antibody RW-C425846 is an HRP-conjugated rabbit polyclonal antibody to AKT2 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AKT2, Synonym: AKT2 | PKB beta | PKBBETA | PRKBB | Protein kinase Akt-2 | Protein kinase B beta | RAC-PK-beta | Rac protein kinase beta | RAC-BETA | HIHGHH | PKBB, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with FITC, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human AKT2 (P31751, NP_001617). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Baboon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Dog, Bovine, Bat, Goat, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus, Salmon, Zebrafish, Stickleback (100%)., Epitop: C-Terminus, Specificit: Human AKT2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31751 NCBI: NM_001626 NP_001617.1
469.00 € 469.0 EUR
Rabbit anti‑Human AKT2 Polyclonal RW-C425844-100
Antibody: AKT2 Rabbit anti-Human Polyclonal (C-Terminus) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: AKT2 antibody RW-C425844 is an FITC-conjugated rabbit polyclonal antibody to AKT2 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AKT2, Synonym: AKT2 | PKB beta | PKBBETA | PRKBB | Protein kinase Akt-2 | Protein kinase B beta | RAC-PK-beta | Rac protein kinase beta | RAC-BETA | HIHGHH | PKBB, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human AKT2 (P31751, NP_001617). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Baboon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Dog, Bovine, Bat, Goat, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus, Salmon, Zebrafish, Stickleback (100%)., Epitop: C-Terminus, Specificit: Human AKT2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31751 NCBI: NM_001626 NP_001617.1
469.00 € 469.0 EUR
Rabbit anti‑Human AKT2 Polyclonal RW-C209572-400
Antibody: AKT2 Rabbit anti-Human Polyclonal Antibody, Application: WB, ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Rabbit, Sheep, Chicken, Xenopus, Format: Unconjugated, Unmodified, Descriptio: AKT2 antibody RW-C209572 is an unconjugated rabbit polyclonal antibody to AKT2 from human. It is reactive with human, mouse, rat and other species. Validated for ELISA and WB., Targe: Human AKT2, Synonym: AKT2 | PKB beta | PKBBETA | PRKBB | Protein kinase Akt-2 | Protein kinase B beta | RAC-PK-beta | Rac protein kinase beta | RAC-BETA | HIHGHH | PKBB, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Rabbit, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: A five residue synthetic peptide based on the human Akt2, coupled to KLH., Specificit: Detects a 65kD protein, corresponding to the molecular mass of Akt2 PKB beta on SDS PAGE immunoblots. Does not react with PKB alpha (Akt1) or PKB gamma (Akt3)., Application: Western blot
ELISA, Presentatio: TBS, 0.09% Sodium Azide, 50% Glycerol, Storag: Store at -20°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31751 NCBI: NM_001626 NP_001617.1
413.00 € 413.0 EUR
Rabbit anti‑Human AKT2 IgG Polyclonal RW-C126678-400
Antibody: AKT2 Rabbit anti-Human Polyclonal (Azide-free) Antibody, Application: WB, ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Sheep, Chicken, Xenopus, Format: Unconjugated, Azide-free, Descriptio: AKT2 antibody RW-C126678 is an unconjugated rabbit polyclonal antibody to AKT2 from human. It is reactive with human, mouse, rat and other species. Validated for ELISA and WB., Targe: Human AKT2, Synonym: AKT2 | PKB beta | PKBBETA | PRKBB | Protein kinase Akt-2 | Protein kinase B beta | RAC-PK-beta | Rac protein kinase beta | RAC-BETA | HIHGHH | PKBB, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Azide-free, Immunoge: A five residue synthetic peptide based on the human Akt2, coupled to KLH., Specificit: Recognizes human Akt2. Species cross-reactivity: mouse, rat, bovine, chicken, canine, guinea pig, hamster, monkey, porcine, sheep, xenopus., Application: Western blot
ELISA, Usag: Suitable for use in ELISA and Western Blot. The applications listed have been tested for the unmodified form of this product. Other forms have not been tested., Presentatio: Rabbit immunoglobulin in 0.1 M Tris-acetate buffer, 0.1% sodium azide, Storag: May be stored at 4°C for short-term only. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Aliquots are stable for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31751 NCBI: NM_001626 NP_001617.1
585.00 € 585.0 EUR
Rabbit anti‑Human AKT1 + AKT2 + AKT3 Polyclonal RW-C351805-100
Antibody: AKT1 + AKT2 + AKT3 Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Pig, Sheep, Chicken, Zebrafish, Format: Unconjugated, Unmodified, Descriptio: AKT1 + AKT2 + AKT3 antibody RW-C351805 is an unconjugated rabbit polyclonal antibody to AKT1 + AKT2 + AKT3 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1 + AKT2 + AKT3, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Pig, Sheep, Chicken, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human AKT., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of AKT protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee.
299.00 € 299.0 EUR
Rabbit anti‑Human AKT1 + AKT2 + AKT3 Polyclonal RW-C351798-100
Antibody: AKT1 + AKT2 + AKT3 Rabbit anti-Human Polyclonal (pSer473) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Sheep, Zebrafish, Format: Unconjugated, Unmodified, Descriptio: AKT1 + AKT2 + AKT3 antibody RW-C351798 is an unconjugated rabbit polyclonal antibody to AKT1 + AKT2 + AKT3 (pSer473) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1 + AKT2 + AKT3, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human AKT., Epitop: pSer473, Specificit: Recognizes endogenous levels of AKT (pS473) protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee.
315.00 € 315.0 EUR
Rabbit anti‑Human AKT1 + AKT2 + AKT3 Polyclonal RW-C354521-100
Antibody: AKT1 + AKT2 + AKT3 Rabbit anti-Human Polyclonal (Internal) Antibody, Application: IHC, IHC-P, ICC, IF, WB, Reactivity: Human, Mouse, Rat, Bovine, Sheep, Format: Unconjugated, Unmodified, Descriptio: AKT1 + AKT2 + AKT3 antibody RW-C354521 is an unconjugated rabbit polyclonal antibody to AKT1 + AKT2 + AKT3 (Internal) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IF, IHC and WB., Targe: Human AKT1 + AKT2 + AKT3, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the central region of human AKT., Epitop: Internal, Specificit: Recognizes endogenous levels of AKT protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
ICC (1:100 - 1:500)
Immunofluorescence
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee.
299.00 € 299.0 EUR
Rabbit anti‑Human AKT1 + AKT2 + AKT3 Polyclonal RW-C354245-100
Antibody: AKT1 + AKT2 + AKT3 Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: IHC, IHC-P, WB, IP, Reactivity: Human, Mouse, Rat, Bovine, Sheep, Zebrafish, Format: Unconjugated, Unmodified, Descriptio: AKT1 + AKT2 + AKT3 antibody RW-C354245 is an unconjugated rabbit polyclonal antibody to AKT1 + AKT2 + AKT3 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC, IP and WB., Targe: Human AKT1 + AKT2 + AKT3, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human AKT., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of AKT protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000)
Immunoprecipitation (1:10 - 1:100), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee.
299.00 € 299.0 EUR
Rabbit anti‑Human AKT1 + AKT2 + AKT3 Polyclonal RW-C358908-30
Antibody: AKT1 + AKT2 + AKT3 Rabbit anti-Human Polyclonal (N-Terminus) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: AKT1 + AKT2 + AKT3 antibody RW-C358908 is an unconjugated rabbit polyclonal antibody to AKT1 + AKT2 + AKT3 (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1 + AKT2 + AKT3, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the N-Terminus of human AKT., Epitop: N-Terminus, Specificit: Recognizes endogenous levels of AKT protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Aliquot and store at -20°C for 1 year. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee.
351.00 € 351.0 EUR
Rabbit anti‑Human AKT1 + AKT2 + AKT3 Polyclonal RW-C358909-30
Antibody: AKT1 + AKT2 + AKT3 Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: AKT1 + AKT2 + AKT3 antibody RW-C358909 is an unconjugated rabbit polyclonal antibody to AKT1 + AKT2 + AKT3 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1 + AKT2 + AKT3, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human AKT., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of AKT (pT450) protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Aliquot and store at -20°C for 1 year. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee.
379.00 € 379.0 EUR
Rabbit anti‑Human AKT1 IgG Polyclonal RW-C481302-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (aa121-170) (Biotin) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus, Format: Biotin, Unmodified, Other formats: HRP FITC Unconjugated, Descriptio: AKT1 antibody RW-C481302 is a biotin-conjugated rabbit polyclonal antibody to AKT1 (aa121-170) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with HRP, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa121-170 of human AKT1 (P31749, NP_005154). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Xenopus (100%); Pig, Lizard (93%); Sheep, Goat, Bovine (86%); Baboon, Elephant, Rabbit, Salmon (85%)., Epitop: aa121-170, Specificit: Human AKT1, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
469.00 € 469.0 EUR
Rabbit anti‑Human AKT1 IgG Polyclonal RW-C481303-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (aa121-170) (HRP) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus, Format: Horseradish Peroxidase, Unmodified, Other formats: Biotin FITC Unconjugated, Descriptio: AKT1 antibody RW-C481303 is an HRP-conjugated rabbit polyclonal antibody to AKT1 (aa121-170) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa121-170 of human AKT1 (P31749, NP_005154). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Xenopus (100%); Pig, Lizard (93%); Sheep, Goat, Bovine (86%); Baboon, Elephant, Rabbit, Salmon (85%)., Epitop: aa121-170, Specificit: Human AKT1, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
469.00 € 469.0 EUR
Rabbit anti‑Human AKT1 IgG Polyclonal RW-C481304-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (aa121-170) (FITC) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus, Format: FITC, Unmodified, Other formats: Biotin HRP Unconjugated, Descriptio: AKT1 antibody RW-C481304 is an FITC-conjugated rabbit polyclonal antibody to AKT1 (aa121-170) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa121-170 of human AKT1 (P31749, NP_005154). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Xenopus (100%); Pig, Lizard (93%); Sheep, Goat, Bovine (86%); Baboon, Elephant, Rabbit, Salmon (85%)., Epitop: aa121-170, Specificit: Human AKT1, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
469.00 € 469.0 EUR
Rabbit anti‑Human AKT1 IgG Polyclonal RW-C481307-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (aa121-170) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: AKT1 antibody RW-C481307 is an HRP-conjugated rabbit polyclonal antibody to AKT1 (aa121-170) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Protein A/G purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa121-170 of human AKT1 (P31749, NP_005154). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Xenopus (100%); Pig, Lizard (93%); Sheep, Goat, Bovine (86%); Baboon, Elephant, Rabbit, Salmon (85%)., Epitop: aa121-170, Specificit: Human AKT1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested. Applications listed above are for the unconjugated form of this antibody. The conjugated antibody has not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
442.00 € 442.0 EUR
Rabbit anti‑Human AKT1 IgG Polyclonal RW-C481306-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (aa121-170) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: AKT1 antibody RW-C481306 is an FITC-conjugated rabbit polyclonal antibody to AKT1 (aa121-170) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Protein A/G purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa121-170 of human AKT1 (P31749, NP_005154). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Xenopus (100%); Pig, Lizard (93%); Sheep, Goat, Bovine (86%); Baboon, Elephant, Rabbit, Salmon (85%)., Epitop: aa121-170, Specificit: Human AKT1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested. Applications listed above are for the unconjugated form of this antibody. The conjugated antibody has not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
442.00 € 442.0 EUR
Rabbit anti‑Human AKT1 IgG Polyclonal RW-C481305-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (aa121-170) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: AKT1 antibody RW-C481305 is a biotin-conjugated rabbit polyclonal antibody to AKT1 (aa121-170) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Protein A/G purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa121-170 of human AKT1 (P31749, NP_005154). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Xenopus (100%); Pig, Lizard (93%); Sheep, Goat, Bovine (86%); Baboon, Elephant, Rabbit, Salmon (85%)., Epitop: aa121-170, Specificit: Human AKT1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested. Applications listed above are for the unconjugated form of this antibody. The conjugated antibody has not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
442.00 € 442.0 EUR
Rabbit anti‑Human AKT1 Polyclonal RW-C351854-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: IHC, IHC-P, WB, IP, Reactivity: Human, Mouse, Rat, Bovine, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: AKT1 antibody RW-C351854 is an unconjugated rabbit polyclonal antibody to AKT1 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC, IP and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human AKT., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of AKT protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000)
Immunoprecipitation (1:10 - 1:100), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
299.00 € 299.0 EUR
Rabbit anti‑Human AKT1 Polyclonal RW-C353925-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Pig, Sheep, Chicken, Zebrafish, Format: Unconjugated, Unmodified, Descriptio: AKT1 antibody RW-C353925 is an unconjugated rabbit polyclonal antibody to AKT1 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Pig, Sheep, Chicken, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human AKT., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of AKT protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
299.00 € 299.0 EUR
Rabbit anti‑Human AKT1 Polyclonal RW-C358425-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Monkey, Mouse, Rat, Pig, Sheep, Chicken, Zebrafish, Format: Unconjugated, Unmodified, Descriptio: AKT1 antibody RW-C358425 is an unconjugated rabbit polyclonal antibody to AKT1 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Pig, Sheep, Chicken, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human AKT (pY474)., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of AKT (pY474) protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
315.00 € 315.0 EUR
Rabbit anti‑Human AKT1 Polyclonal RW-C413186-100
Antibody: AKT1 Rabbit anti-Human Polyclonal (pTyr326) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Sheep, Format: Unconjugated, Unmodified, Descriptio: AKT1 antibody RW-C413186 is an unconjugated rabbit polyclonal antibody to AKT1 (pTyr326) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the central region of human AKT (pY326)., Epitop: pTyr326, Specificit: Recognizes endogenous levels of AKT (pY326) protein., Application: Western blot (1:500 - 1:1000), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Aliquot and store at -20°C for 1 year. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
341.00 € 341.0 EUR
Rabbit anti‑Human AKT1 IgG Polyclonal RW-C122636-50
Antibody: AKT1 Rabbit anti-Human Polyclonal (pSer473) Antibody, Application: IHC, WB, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish, Format: Unconjugated, Unmodified, Descriptio: AKT1 antibody RW-C122636 is an unconjugated rabbit polyclonal antibody to AKT1 (pSer473) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic phosphopeptide corresponding to human Akt around the phosphorylation site of serine 473 (Q-F-SP-Y-S)., Epitop: pSer473, Specificit: Recognizes human Akt1 when phosphorylated at serine 473. Species cross-reactivity: mouse, rat., Application: IHC (1:50 - 1:100)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Suitable for use in Western Blot and Immunohistochemistry. Western Blot: 1:500-1:1000. Immunohistochemistry: 1:50-1:100., Presentatio: PBS (without Mg2+, Ca2+), pH 7.4, 150 mM NaCl, 0.02% Sodium Azide, 50% Glycerol, Storag: May be stored at 4°C for short-term only. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Aliquots are stable for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
489.00 € 489.0 EUR
Rabbit anti‑Human AKT1 IgG Polyclonal RW-C126664-50
Antibody: AKT1 Rabbit anti-Human Polyclonal Antibody, Application: ICC, WB, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish, Format: Unconjugated, Unmodified, Descriptio: AKT1 antibody RW-C126664 is an unconjugated rabbit polyclonal antibody to AKT1 from human. It is reactive with human, mouse, rat and other species. Validated for ICC and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Horse, Pig, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic non-phosphopeptide corresponding to human Akt around the phosphorylation site of threonine 308 (M-K-TP-F-C)., Specificit: Recognizes human Akt. Species cross-reactivity: mouse, rat., Application: ICC (1:50 - 1:100)
Western blot (1:500 - 1:1000), Usag: Suitable for use in Western Blot and Immunocytochemistry. Western Blot: 1:500-1:1000. Immunocytochemistry: 1:50-1:100., Presentatio: PBS (without Mg2+, Ca2+), pH 7.4, 150 mM NaCl, 0.02% Sodium Azide, 50% Glycerol, Storag: May be stored at 4°C for short-term only. For long-term storage, aliquot to avoid freeze-thaw cycles and freeze at -70°C. Aliquots are stable for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
489.00 € 489.0 EUR
Rabbit anti‑Human AKT1 IgG Monoclonal RW-C126670-100
Antibody: AKT1 Rabbit anti-Human Monoclonal (aa404-418) Antibody, Application: WB, IP, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: AKT1 antibody RW-C126670 is an unconjugated rabbit monoclonal antibody to AKT1 (aa404-418) from human. It is reactive with human, mouse, rat and other species. Validated for IP and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: IgG Monoclonal, Conjugation: Unconjugated, Purificatio: Tissue culture supernatant, Modification: Unmodified, Immunoge: Synthetic peptide corresponding to the C-Terminus aa466-480, C-RPHFPQFSYSASGTA of rat Akt1/PKB alpha (KLH). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Horse, Pig, Opossum, Turkey, Chicken, Lizard, Stickleback (100%); Goat, Xenopus (93%); Bat, Rabbit, Pufferfish, Zebrafish (87%)., Epitop: aa404-418, Specificit: Recognizes human Akt1/PKB alpha. Species cross-reactivity: rat, mouse., Application: Western blot (1:1000)
Immunoprecipitation, Usag: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 1:1000., Presentatio: 0.05% Sodium Azide, Storag: May be stored at 4°C for short-term only. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Aliquots are stable for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
801.00 € 801.0 EUR
Rabbit anti‑Human AKT1 Polyclonal RW-C761122-30
Antibody: AKT1 Rabbit anti-Human Polyclonal Antibody, Application: IHC, WB, Reactivity: Human, Mouse, Rat, Bovine, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: AKT1 antibody RW-C761122 is an unconjugated rabbit polyclonal antibody to AKT1 from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AKT1, Synonym: AKT1 | AKT | AKT-1 | C-AKT | Pan-AKT | PKB alpha | PKBalpha | Proto-oncogene c-Akt | Protein kinase B | Rac protein kinase alpha | PRKBA | Protein kinase B alpha | RAC-PK-alpha | PKB | PKB-ALPHA | RAC | RAC-ALPHA, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the N-term region of human AKT. The exact sequence is proprietary., Specificit: Recognizes endogenous levels of AKT (pT72) protein., Application: IHC (1:50 - 1:100)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: 0.42% Potassium Phosphate, pH 7.3, 0.87% NaCl, 0.01% Sodium Azide, 30% Glycerol, Storag: Upon delivery, aliquot and store at -20°C for 1 year. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKT: Uniprot: P31749 NCBI: NM_005163 NP_005154.2
379.00 € 379.0 EUR
Rabbit anti‑Mouse AKIRIN2 Polyclonal RW-C474147-100
Antibody: AKIRIN2 Rabbit anti-Mouse Polyclonal (C-Terminus) (HRP) Antibody, Application: WB, Reactivity: Mouse, Human, Chimpanzee, Rat, Bovine, Horse, Pig, Rabbit, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: AKIRIN2 antibody RW-C474147 is an HRP-conjugated rabbit polyclonal antibody to AKIRIN2 (C-Terminus) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse AKIRIN2, Synonym: AKIRIN2 | Akirin 2 | C6orf166 | DJ486L4.2 | Akirin-2 | FBI1, Hos: Rabbit, Reactivit: Mouse, Human, Chimpanzee, Rat, Bovine, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of mouse Akirin2 (B1AXD8, NP_001007590). Percent identity by BLAST analysis: Human, Chimpanzee, Mouse, Rat, Sheep, Bovine, Rabbit, Horse, Pig (100%)., Epitop: C-Terminus, Specificit: Mouse AKIRIN2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKIRIN: Uniprot: Q53H80 NCBI: NM_018064 NP_060534.1
469.00 € 469.0 EUR
Rabbit anti‑Mouse AKIRIN2 Polyclonal RW-C474145-100
Antibody: AKIRIN2 Rabbit anti-Mouse Polyclonal (C-Terminus) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Human, Chimpanzee, Rat, Bovine, Horse, Pig, Rabbit, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: AKIRIN2 antibody RW-C474145 is a biotin-conjugated rabbit polyclonal antibody to AKIRIN2 (C-Terminus) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse AKIRIN2, Synonym: AKIRIN2 | Akirin 2 | C6orf166 | DJ486L4.2 | Akirin-2 | FBI1, Hos: Rabbit, Reactivit: Mouse, Human, Chimpanzee, Rat, Bovine, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of mouse Akirin2 (B1AXD8, NP_001007590). Percent identity by BLAST analysis: Human, Chimpanzee, Mouse, Rat, Sheep, Bovine, Rabbit, Horse, Pig (100%)., Epitop: C-Terminus, Specificit: Mouse AKIRIN2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKIRIN: Uniprot: Q53H80 NCBI: NM_018064 NP_060534.1
469.00 € 469.0 EUR
Rabbit anti‑Mouse AKIRIN2 Polyclonal RW-C474146-100
Antibody: AKIRIN2 Rabbit anti-Mouse Polyclonal (C-Terminus) (FITC) Antibody, Application: WB, Reactivity: Mouse, Human, Chimpanzee, Rat, Bovine, Horse, Pig, Rabbit, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: AKIRIN2 antibody RW-C474146 is an FITC-conjugated rabbit polyclonal antibody to AKIRIN2 (C-Terminus) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse AKIRIN2, Synonym: AKIRIN2 | Akirin 2 | C6orf166 | DJ486L4.2 | Akirin-2 | FBI1, Hos: Rabbit, Reactivit: Mouse, Human, Chimpanzee, Rat, Bovine, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of mouse Akirin2 (B1AXD8, NP_001007590). Percent identity by BLAST analysis: Human, Chimpanzee, Mouse, Rat, Sheep, Bovine, Rabbit, Horse, Pig (100%)., Epitop: C-Terminus, Specificit: Mouse AKIRIN2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AKIRIN: Uniprot: Q53H80 NCBI: NM_018064 NP_060534.1
469.00 € 469.0 EUR
Rabbit anti‑Human ALK3 / BMPR1A Polyclonal RW-C354568-100
Antibody: ALK3 / BMPR1A Rabbit anti-Human Polyclonal (N-Terminus) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Sheep, Format: Unconjugated, Unmodified, Descriptio: BMPR1A antibody RW-C354568 is an unconjugated rabbit polyclonal antibody to BMPR1A (ALK3) (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ALK3 / BMPR1A, Synonym: BMPR1A | 10q23del | ALK3 | ALK-3 | BMP type-1A receptor | BMPR-1A | CD292 | CD292 antigen | Activin receptor-like kinase 3 | ACVRLK3 | SKR5, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the N-Terminus of human CD292., Epitop: N-Terminus, Specificit: Recognizes endogenous levels of CD292 protein., Application: Western blot (1:500 - 1:1000), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALK3 / BMPR1: Uniprot: P36894 NCBI: NM_004329 NP_004320.2
299.00 € 299.0 EUR
Rabbit anti‑Human ALDOB Polyclonal RW-C442042-100
Antibody: ALDOB Rabbit anti-Human Polyclonal (N-Terminus) (Biotin) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Biotin, Unmodified, Other formats: FITC HRP Unconjugated, Descriptio: ALDOB antibody RW-C442042 is a biotin-conjugated rabbit polyclonal antibody to ALDOB (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ALDOB, Synonym: ALDOB | ALDB | ALDO2 | Liver-type aldolase | Aldolase 2, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide directed towards the N-Terminus of Human ALDOB. Percent identity by BLAST analysis: Dog, Pig, Rat, Horse, Human, Mouse, Sheep, Bovine, Rabbit, Guinea pig (100%); Yeast (90%); Zebrafish (75%)., Epitop: N-Terminus, Specificit: Human ALDOB, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALDO: Uniprot: P05062 NCBI: NM_000035 NP_000026.2
469.00 € 469.0 EUR
Rabbit anti‑Human ALDOB Polyclonal RW-C442043-100
Antibody: ALDOB Rabbit anti-Human Polyclonal (N-Terminus) (FITC) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: FITC, Unmodified, Other formats: Biotin HRP Unconjugated, Descriptio: ALDOB antibody RW-C442043 is an FITC-conjugated rabbit polyclonal antibody to ALDOB (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ALDOB, Synonym: ALDOB | ALDB | ALDO2 | Liver-type aldolase | Aldolase 2, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide directed towards the N-Terminus of Human ALDOB. Percent identity by BLAST analysis: Dog, Pig, Rat, Horse, Human, Mouse, Sheep, Bovine, Rabbit, Guinea pig (100%); Yeast (90%); Zebrafish (75%)., Epitop: N-Terminus, Specificit: Human ALDOB, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALDO: Uniprot: P05062 NCBI: NM_000035 NP_000026.2
469.00 € 469.0 EUR
Rabbit anti‑Human ALDOB Polyclonal RW-C442044-100
Antibody: ALDOB Rabbit anti-Human Polyclonal (N-Terminus) (HRP) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Biotin FITC Unconjugated, Descriptio: ALDOB antibody RW-C442044 is an HRP-conjugated rabbit polyclonal antibody to ALDOB (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ALDOB, Synonym: ALDOB | ALDB | ALDO2 | Liver-type aldolase | Aldolase 2, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide directed towards the N-Terminus of Human ALDOB. Percent identity by BLAST analysis: Dog, Pig, Rat, Horse, Human, Mouse, Sheep, Bovine, Rabbit, Guinea pig (100%); Yeast (90%); Zebrafish (75%)., Epitop: N-Terminus, Specificit: Human ALDOB, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALDO: Uniprot: P05062 NCBI: NM_000035 NP_000026.2
469.00 € 469.0 EUR
Goat anti‑Human ALDOA / Aldolase A Polyclonal RW-C305861-100
Antibody: ALDOA / Aldolase A Goat anti-Human Polyclonal (aa86-96) Antibody, Application: WB, Peptide-ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Guinea pig, Horse, Rabbit, Sheep, Xenopus, Format: Unconjugated, Unmodified, Descriptio: Aldolase A antibody RW-C305861 is an unconjugated goat polyclonal antibody to Aldolase A (ALDOA) (aa86-96) from human. It is reactive with human, mouse, rat and other species. Validated for Peptide-ELISA and WB., Targe: Human ALDOA / Aldolase A, Synonym: ALDOA | ALDA | Aldolase | GSD12 | Muscle-type aldolase | Lung cancer antigen NY-LU-1, Hos: Goat, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Guinea pig, Horse, Rabbit, Sheep, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide., Modification: Unmodified, Immunoge: Peptide with sequence C-QKADDGRPFPQ, from the internal region of the protein sequence according to NP_000025.1NP_001230106.1., Epitop: aa86-96, Specificit: Human ALDOA / Aldolase. This antibody is expected to recognize both reported isoforms (P_000025.1; NP_001230106.1). Reported variants represent identical protein: NP_908930.1, NP_908932.1, NP_001121089.1, NP_000025.1., Application: Western blot (0.03 - 0.1 µg/ml)
Peptide Enzyme-Linked Immunosorbent Assay (1:128000), Usag: Peptide ELISA: antibody detection limit dilution 1:128000. Western blot: Approx 39kD band observed in Human, Mouse and Rat Skeletal Muscle lysates (calculated MW of 39.4kD according to NP_000025.1). Recommended concentration: 0.03-0.1 ug/ml., Presentatio: TBS, pH 7.3, 0.02% Sodium Azide, 0.5% BSA, Storag: Aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALDOA / Aldolase : Uniprot: P04075 NCBI: NM_000034 NP_000025.1
503.00 € 503.0 EUR
Rabbit anti‑Human ALDH1A1 / ALDH1 Polyclonal RW-C465397-100
Antibody: ALDH1A1 / ALDH1 Rabbit anti-Human Polyclonal (N-Terminus) (FITC) Antibody, Application: WB, Reactivity: Human, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ALDH1 antibody RW-C465397 is an FITC-conjugated rabbit polyclonal antibody to ALDH1 (ALDH1A1) (N-Terminus) from human. It is reactive with human, bovine, dog and other species. Validated for WB., Targe: Human ALDH1A1 / ALDH1, Synonym: ALDH1A1 | Acetaldehyde dehydrogenase 1 | ALDH class 1 | ALDC | Aldehyde dehydrogenase 1 | ALDH-E1 | ALDH1 | ALDH11 | PUMB1 | RALDH 1 | RALDH1 | ALHDII | Retinal dehydrogenase 1 | Retinaldehyde dehydrogenase 1, Hos: Rabbit, Reactivit: Human, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide directed towards the N-Terminus of Human ALDH1A1. Percent identity by BLAST analysis: Dog, Pig, Horse, Human, Sheep, Bovine (100%); Rat, Mouse, Guinea pig (92%); Rabbit (86%); Zebrafish (82%)., Epitop: N-Terminus, Specificit: Human ALDH1A1 / ALDH1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALDH1A1 / ALDH: Uniprot: P00352 NCBI: NM_000689 NP_000680.2
469.00 € 469.0 EUR
Rabbit anti‑Human ALDH1A1 / ALDH1 Polyclonal RW-C465396-100
Antibody: ALDH1A1 / ALDH1 Rabbit anti-Human Polyclonal (N-Terminus) (Biotin) Antibody, Application: WB, Reactivity: Human, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ALDH1 antibody RW-C465396 is a biotin-conjugated rabbit polyclonal antibody to ALDH1 (ALDH1A1) (N-Terminus) from human. It is reactive with human, bovine, dog and other species. Validated for WB., Targe: Human ALDH1A1 / ALDH1, Synonym: ALDH1A1 | Acetaldehyde dehydrogenase 1 | ALDH class 1 | ALDC | Aldehyde dehydrogenase 1 | ALDH-E1 | ALDH1 | ALDH11 | PUMB1 | RALDH 1 | RALDH1 | ALHDII | Retinal dehydrogenase 1 | Retinaldehyde dehydrogenase 1, Hos: Rabbit, Reactivit: Human, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide directed towards the N-Terminus of Human ALDH1A1. Percent identity by BLAST analysis: Dog, Pig, Horse, Human, Sheep, Bovine (100%); Rat, Mouse, Guinea pig (92%); Rabbit (86%); Zebrafish (82%)., Epitop: N-Terminus, Specificit: Human ALDH1A1 / ALDH1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALDH1A1 / ALDH: Uniprot: P00352 NCBI: NM_000689 NP_000680.2
469.00 € 469.0 EUR
Rabbit anti‑Human ALDH1A1 / ALDH1 Polyclonal RW-C465398-100
Antibody: ALDH1A1 / ALDH1 Rabbit anti-Human Polyclonal (N-Terminus) (HRP) Antibody, Application: WB, Reactivity: Human, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ALDH1 antibody RW-C465398 is an HRP-conjugated rabbit polyclonal antibody to ALDH1 (ALDH1A1) (N-Terminus) from human. It is reactive with human, bovine, dog and other species. Validated for WB., Targe: Human ALDH1A1 / ALDH1, Synonym: ALDH1A1 | Acetaldehyde dehydrogenase 1 | ALDH class 1 | ALDC | Aldehyde dehydrogenase 1 | ALDH-E1 | ALDH1 | ALDH11 | PUMB1 | RALDH 1 | RALDH1 | ALHDII | Retinal dehydrogenase 1 | Retinaldehyde dehydrogenase 1, Hos: Rabbit, Reactivit: Human, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide directed towards the N-Terminus of Human ALDH1A1. Percent identity by BLAST analysis: Dog, Pig, Horse, Human, Sheep, Bovine (100%); Rat, Mouse, Guinea pig (92%); Rabbit (86%); Zebrafish (82%)., Epitop: N-Terminus, Specificit: Human ALDH1A1 / ALDH1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALDH1A1 / ALDH: Uniprot: P00352 NCBI: NM_000689 NP_000680.2
469.00 € 469.0 EUR
Goat anti‑Human ALDH1A1 / ALDH1 Polyclonal RW-B2497-50
Antibody: ALDH1A1 / ALDH1 Goat anti-Human Polyclonal (aa476-488) Antibody, Application: IHC, IHC-P, WB, Peptide-ELISA, Reactivity: Human, Bovine, Sheep, Format: Unconjugated, Unmodified, Descriptio: ALDH1 antibody RW-B2497 is an unconjugated goat polyclonal antibody to ALDH1 (ALDH1A1) (aa476-488) from human. It is reactive with human, bovine and sheep. Validated for IHC, Peptide-ELISA and WB. Tested on 20 paraffin-embedded human tissues. Cited in 1 publication., Targe: Human ALDH1A1 / ALDH1, Synonym: ALDH1A1 | Acetaldehyde dehydrogenase 1 | ALDH class 1 | ALDC | Aldehyde dehydrogenase 1 | ALDH-E1 | ALDH1 | ALDH11 | PUMB1 | RALDH 1 | RALDH1 | ALHDII | Retinal dehydrogenase 1 | Retinaldehyde dehydrogenase 1, Hos: Goat, Reactivit: Human, Bovine, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide., Modification: Unmodified, Immunoge: Peptide with sequence C-RELGEYGFHEYTE, from the internal region of the protein sequence according to NP_000680.2., Epitop: aa476-488, Specificit: Human ALDH1A1., Application: IHC
IHC - Paraffin (2.5 µg/ml)
Western blot (1 - 3 µg/ml)
Peptide Enzyme-Linked Immunosorbent Assay (1:32000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Immunohistochemistry: RW-B2497 was validated for use in immunohistochemistry on a panel of 21 formalin-fixed, paraffin-embedded (FFPE) human tissues after heat induced antigen retrieval in pH 6.0 citrate buffer. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen. The stained slides were evaluated by a pathologist to confirm staining specificity. The optimal working concentration for RW-B2497 was determined to be 2.5 ug/ml., Presentatio: TBS, pH 7.3, 0.02% Sodium Azide, 0.5% BSA, Storag: Aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ALDH1A1 / ALDH: Uniprot: P00352 NCBI: NM_000689 NP_000680.2
485.00 € 485.0 EUR
Rabbit anti‑Human AML1 / RUNX1 IgG Polyclonal RW-C389189-100
Antibody: AML1 / RUNX1 Rabbit anti-Human Polyclonal (aa227-257) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: RUNX1 antibody RW-C389189 is an unconjugated rabbit polyclonal antibody to RUNX1 (AML1) (aa227-257) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AML1 / RUNX1, Synonym: RUNX1 | AMLCR1 | Aml1 oncogene | AML1 | AML1-EVI-1 | CBF-alpha-2 | CBFA2 | Acute myeloid leukemia 1 | EVI-1 | PEBP2A2 | PEA2-alpha B | AML1-EVI-1 fusion protein | Oncogene AML-1 | PEBP2-alpha B | PEBP2aB, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Predicte: Guinea pig, Chicken (at least 90% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN). Percent identity by BLAST analysis: Human, Mouse, Rat, Ferret, Sheep, Bovine, Hamster, Rabbit, Horse, Pig, Zebra finch, Dog (100%); Chicken (97%); Opossum, Guinea pig, Platypus, Lizard (90%); Elephant (84%)., Epitop: aa227-257, Specificit: Human AML1 / RUNX1, Application: IHC
IHC - Paraffin (0.5 - 1 µg/ml)
Western blot (0.5 - 1 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Runt-related transcription factor 1, also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called Core binding factor alpha (CBFa). RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFb which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the gene are associated with several types of leukemia including M2 AML. Mutations are implicated in cases of breast cancer., Presentatio: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide., Reconstitutio: Reconstitute in sterile distilled water., Storag: Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AML1 / RUNX: Uniprot: Q01196 NCBI: NM_001754 NP_001745.2
575.00 € 575.0 EUR
Rabbit anti‑Human ANXA2 / Annexin A2 Polyclonal RW-C353894-100
Antibody: ANXA2 / Annexin A2 Rabbit anti-Human Polyclonal (pSer26) Antibody, Application: WB, IP, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Sheep, Format: Unconjugated, Unmodified, Descriptio: Annexin A2 antibody RW-C353894 is an unconjugated rabbit polyclonal antibody to Annexin A2 (ANXA2) (pSer26) from human. It is reactive with human, mouse, rat and other species. Validated for IP and WB., Targe: Human ANXA2 / Annexin A2, Synonym: ANXA2 | Annexin A2 | Annexin-2 | ANX2 | Calpactin I heavy chain | Chromobindin-8 | CAL1H | Calpactin I heavy polypeptide | Chromobindin 8 | LPC2 | LIP2 | Lipocortin II | p36 | LPC2D | PAP-IV | Protein I | Annexin II | ANX2L4 | Calpactin-1 heavy chain, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the N-Terminus of human Annexin A2 (pS26)., Epitop: pSer26, Specificit: Recognizes endogenous levels of Annexin A2 (pS26) protein., Application: Western blot (1:500 - 1:1000)
Immunoprecipitation (1:10 - 1:100), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANXA2 / Annexin A: Uniprot: P07355 NCBI: NM_001002858 NP_001002858.1
315.00 € 315.0 EUR
Rabbit anti‑Human ANXA2 / Annexin A2 IgG Polyclonal RW-C387974-100
Antibody: ANXA2 / Annexin A2 Rabbit anti-Human Polyclonal (aa179-199) Antibody, Application: IHC, IHC-P, IHC-Fr, WB, Reactivity: Human, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: Annexin A2 antibody RW-C387974 is an unconjugated rabbit polyclonal antibody to Annexin A2 (ANXA2) (aa179-199) from human. It is reactive with human, bat, bovine and other species. Validated for IHC and WB., Targe: Human ANXA2 / Annexin A2, Synonym: ANXA2 | Annexin A2 | Annexin-2 | ANX2 | Calpactin I heavy chain | Chromobindin-8 | CAL1H | Calpactin I heavy polypeptide | Chromobindin 8 | LPC2 | LIP2 | Lipocortin II | p36 | LPC2D | PAP-IV | Protein I | Annexin II | ANX2L4 | Calpactin-1 heavy chain, Hos: Rabbit, Reactivit: Human, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Predicte: Mouse, Rat, Guinea pig (at least 90% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from the middle region of human Annexin A2 (RAEDGSVIDYELIDQDARDLY, aa179-199 of UniProt P07355). Percent identity by BLAST analysis: Human, Ferret, Sheep, Cat, Bovine, Bat, Hamster, Elephant, Rabbit, Horse, Pig, Opossum, Platypus, Dog (100%); Mouse, Rat, Guinea pig (95%); Zebra finch (90%)., Epitop: aa179-199, Specificit: Human ANXA2 / Annexin A2, Application: IHC
IHC - Paraffin (0.5 - 1 µg/ml)
IHC - Frozen (0.5 - 1 µg/ml)
Western blot (0.5 - 1 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Annexin A2 also known as annexin II is a protein that in humans is encoded by the ANXA2 gene. The ANXA2 gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. This protein is a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. Richard et al. (1994) presented an integration of the physical, expression, and genetic maps of human chromosome 15. They placed the ANXA2 gene in their region IV, i.e., 15q21-q22, thus confirming the previous localization., Presentatio: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide/thimerosal., Reconstitutio: Reconstitute in sterile distilled water., Storag: Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANXA2 / Annexin A: Uniprot: P07355 NCBI: NM_001002858 NP_001002858.1
575.00 € 575.0 EUR
Rabbit anti‑Human ANXA2 / Annexin A2 IgG Polyclonal RW-C434444-100
Antibody: ANXA2 / Annexin A2 Rabbit anti-Human Polyclonal (C-Terminus) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Bat, Bovine, Dog, Guinea pig, Horse, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: Annexin A2 antibody RW-C434444 is an FITC-conjugated rabbit polyclonal antibody to Annexin A2 (ANXA2) (C-Terminus) from human. It is reactive with human, mouse, bat and other species. Validated for WB., Targe: Human ANXA2 / Annexin A2, Synonym: ANXA2 | Annexin A2 | Annexin-2 | ANX2 | Calpactin I heavy chain | Chromobindin-8 | CAL1H | Calpactin I heavy polypeptide | Chromobindin 8 | LPC2 | LIP2 | Lipocortin II | p36 | LPC2D | PAP-IV | Protein I | Annexin II | ANX2L4 | Calpactin-1 heavy chain, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Bat, Bovine, Dog, Guinea pig, Horse, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ANXA2 (Q8TBV2, NP_004030). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Sheep, Elephant, Dog, Bovine, Bat, Horse, Guinea pig (100%); Rat, Rabbit, Pig, Opossum, Turkey, Zebra finch, Chicken (92%); Platypus (85%)., Epitop: C-Terminus, Specificit: Human ANXA2 / Annexin A2, Application: Western blot
Applications tested for the base form of this product only, Failed Application: IHC - Paraffin, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANXA2 / Annexin A: Uniprot: P07355 NCBI: NM_001002858 NP_001002858.1
442.00 € 442.0 EUR
Rabbit anti‑Human ANXA2 / Annexin A2 IgG Polyclonal RW-C434442-100
Antibody: ANXA2 / Annexin A2 Rabbit anti-Human Polyclonal (C-Terminus) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Bat, Bovine, Dog, Guinea pig, Horse, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated HRP FITC, Descriptio: Annexin A2 antibody RW-C434442 is a biotin-conjugated rabbit polyclonal antibody to Annexin A2 (ANXA2) (C-Terminus) from human. It is reactive with human, mouse, bat and other species. Validated for WB., Targe: Human ANXA2 / Annexin A2, Synonym: ANXA2 | Annexin A2 | Annexin-2 | ANX2 | Calpactin I heavy chain | Chromobindin-8 | CAL1H | Calpactin I heavy polypeptide | Chromobindin 8 | LPC2 | LIP2 | Lipocortin II | p36 | LPC2D | PAP-IV | Protein I | Annexin II | ANX2L4 | Calpactin-1 heavy chain, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Bat, Bovine, Dog, Guinea pig, Horse, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with HRP, FITC., Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ANXA2 (Q8TBV2, NP_004030). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Sheep, Elephant, Dog, Bovine, Bat, Horse, Guinea pig (100%); Rat, Rabbit, Pig, Opossum, Turkey, Zebra finch, Chicken (92%); Platypus (85%)., Epitop: C-Terminus, Specificit: Human ANXA2 / Annexin A2, Application: Western blot
Applications tested for the base form of this product only, Failed Application: IHC - Paraffin, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANXA2 / Annexin A: Uniprot: P07355 NCBI: NM_001002858 NP_001002858.1
442.00 € 442.0 EUR
Rabbit anti‑Human ANXA2 / Annexin A2 IgG Polyclonal RW-C434443-100
Antibody: ANXA2 / Annexin A2 Rabbit anti-Human Polyclonal (C-Terminus) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Bat, Bovine, Dog, Guinea pig, Horse, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: Annexin A2 antibody RW-C434443 is an HRP-conjugated rabbit polyclonal antibody to Annexin A2 (ANXA2) (C-Terminus) from human. It is reactive with human, mouse, bat and other species. Validated for WB., Targe: Human ANXA2 / Annexin A2, Synonym: ANXA2 | Annexin A2 | Annexin-2 | ANX2 | Calpactin I heavy chain | Chromobindin-8 | CAL1H | Calpactin I heavy polypeptide | Chromobindin 8 | LPC2 | LIP2 | Lipocortin II | p36 | LPC2D | PAP-IV | Protein I | Annexin II | ANX2L4 | Calpactin-1 heavy chain, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Bat, Bovine, Dog, Guinea pig, Horse, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ANXA2 (Q8TBV2, NP_004030). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Sheep, Elephant, Dog, Bovine, Bat, Horse, Guinea pig (100%); Rat, Rabbit, Pig, Opossum, Turkey, Zebra finch, Chicken (92%); Platypus (85%)., Epitop: C-Terminus, Specificit: Human ANXA2 / Annexin A2, Application: Western blot
Applications tested for the base form of this product only, Failed Application: IHC - Paraffin, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANXA2 / Annexin A: Uniprot: P07355 NCBI: NM_001002858 NP_001002858.1
442.00 € 442.0 EUR
Goat anti‑Human ANXA2 / Annexin A2 Polyclonal RW-C20123-100
Antibody: ANXA2 / Annexin A2 Goat anti-Human Polyclonal (aa20-34) Antibody, Application: WB, Peptide-ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: Annexin A2 antibody RW-C20123 is an unconjugated goat polyclonal antibody to Annexin A2 (ANXA2) (aa20-34) from human. It is reactive with human, mouse, rat and other species. Validated for Peptide-ELISA and WB., Targe: Human ANXA2 / Annexin A2, Synonym: ANXA2 | Annexin A2 | Annexin-2 | ANX2 | Calpactin I heavy chain | Chromobindin-8 | CAL1H | Calpactin I heavy polypeptide | Chromobindin 8 | LPC2 | LIP2 | Lipocortin II | p36 | LPC2D | PAP-IV | Protein I | Annexin II | ANX2L4 | Calpactin-1 heavy chain, Hos: Goat, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide., Modification: Unmodified, Immunoge: Peptide with sequence STVHEILCKLSLEGD, from the N-Terminus of protein sequence according to NP_001002858.1NP_004030.1., Epitop: aa20-34, Specificit: Human ANXA2 / Annexin A2. This antibody is expected to recognise both reported isoforms. NP_004030.1, NP_001002857.1and NP_001129487.1 are varients of isoform 2., Application: Western blot (0.5 - 3 µg/ml)
Peptide Enzyme-Linked Immunosorbent Assay (1:1000), Presentatio: TBS, pH 7.3, 0.02% Sodium Azide, 0.5% BSA, Storag: Aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANXA2 / Annexin A: Uniprot: P07355 NCBI: NM_001002858 NP_001002858.1
503.00 € 503.0 EUR
Rabbit anti‑Human ANT2 / SLC25A5 Polyclonal RW-C351813-100
Antibody: ANT2 / SLC25A5 Rabbit anti-Human Polyclonal (Internal) Antibody, Application: WB, Reactivity: Human, Monkey, Rat, Bovine, Sheep, Format: Unconjugated, Unmodified, Descriptio: SLC25A5 antibody RW-C351813 is an unconjugated rabbit polyclonal antibody to SLC25A5 (ANT2) (Internal) from human. It is reactive with human, rat, bovine and other species. Validated for WB., Targe: Human ANT2 / SLC25A5, Synonym: SLC25A5 | AAC2 | 2F1 | ANT 2 | ADP/ATP carrier protein | ADP/ATP translocase 2 | ADP,ATP carrier protein 2 | ATP/ADP translocator isoform-2 | T3 | ANT2 | T2, Hos: Rabbit, Reactivit: Human, Monkey, Rat, Bovine, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the central region of human ANT2., Epitop: Internal, Specificit: Recognizes endogenous levels of ANT2 protein., Application: Western blot (1:500 - 1:1000), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANT2 / SLC25A: Uniprot: P05141 NCBI: NM_001152 NP_001143.2
299.00 € 299.0 EUR
Rabbit anti‑Human ANP32B IgG Polyclonal RW-C455648-100
Antibody: ANP32B Rabbit anti-Human Polyclonal (aa36-85) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Sheep, Xenopus, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ANP32B antibody RW-C455648 is an FITC-conjugated rabbit polyclonal antibody to ANP32B (aa36-85) from human. It is reactive with human, bat, bovine and other species. Validated for WB., Targe: Human ANP32B, Synonym: ANP32B | APRIL | Phapi2b | PHAPI2 | Phapi2a | Silver-stainable protein SSP29 | SSP29, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Sheep, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa36-85 of human ANP32B (Q92688, NP_006392). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Sheep, Elephant, Dog, Bovine, Bat, Horse, Pig, Guinea pig, Xenopus (100%); Galago, Mouse, Rat, Panda, Opossum, Zebra finch, Platypus, Salmon, Smelt, Stickleback, Zebrafish (92%); Sablefish (91%); Drosophila (90%); Turkey, Chicken, Trout (85%)., Epitop: aa36-85, Specificit: Human ANP32B / APRIL, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANP32: Uniprot: Q92688 NCBI: NM_006401 NP_006392.1
469.00 € 469.0 EUR
Rabbit anti‑Human ANP32B IgG Polyclonal RW-C455646-100
Antibody: ANP32B Rabbit anti-Human Polyclonal (aa36-85) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Sheep, Xenopus, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ANP32B antibody RW-C455646 is a biotin-conjugated rabbit polyclonal antibody to ANP32B (aa36-85) from human. It is reactive with human, bat, bovine and other species. Validated for WB., Targe: Human ANP32B, Synonym: ANP32B | APRIL | Phapi2b | PHAPI2 | Phapi2a | Silver-stainable protein SSP29 | SSP29, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Sheep, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa36-85 of human ANP32B (Q92688, NP_006392). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Sheep, Elephant, Dog, Bovine, Bat, Horse, Pig, Guinea pig, Xenopus (100%); Galago, Mouse, Rat, Panda, Opossum, Zebra finch, Platypus, Salmon, Smelt, Stickleback, Zebrafish (92%); Sablefish (91%); Drosophila (90%); Turkey, Chicken, Trout (85%)., Epitop: aa36-85, Specificit: Human ANP32B / APRIL, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANP32: Uniprot: Q92688 NCBI: NM_006401 NP_006392.1
469.00 € 469.0 EUR
Rabbit anti‑Human ANP32B IgG Polyclonal RW-C455650-100
Antibody: ANP32B Rabbit anti-Human Polyclonal (aa36-85) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Sheep, Xenopus, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ANP32B antibody RW-C455650 is an HRP-conjugated rabbit polyclonal antibody to ANP32B (aa36-85) from human. It is reactive with human, bat, bovine and other species. Validated for WB., Targe: Human ANP32B, Synonym: ANP32B | APRIL | Phapi2b | PHAPI2 | Phapi2a | Silver-stainable protein SSP29 | SSP29, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Sheep, Xenopus (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa36-85 of human ANP32B (Q92688, NP_006392). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Sheep, Elephant, Dog, Bovine, Bat, Horse, Pig, Guinea pig, Xenopus (100%); Galago, Mouse, Rat, Panda, Opossum, Zebra finch, Platypus, Salmon, Smelt, Stickleback, Zebrafish (92%); Sablefish (91%); Drosophila (90%); Turkey, Chicken, Trout (85%)., Epitop: aa36-85, Specificit: Human ANP32B / APRIL, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANP32: Uniprot: Q92688 NCBI: NM_006401 NP_006392.1
469.00 € 469.0 EUR
Rabbit anti‑Human ANGPTL3 Polyclonal RW-C313196-10
Antibody: ANGPTL3 Rabbit anti-Human Polyclonal (aa32-48) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Goat, Horse, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: ANGPTL3 antibody RW-C313196 is an unconjugated rabbit polyclonal antibody to ANGPTL3 (aa32-48) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ANGPTL3, Synonym: ANGPTL3 | ANGPT5 | ANG-5 | Angiopoietin-5 | Angiopoietin-like 3 | Angiopoietin-related protein 3 | FHBL2 | Angiopoietin 5 | Angiopoietin-like protein 3, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Goat, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the N-Terminus of human ANGPTL3(32-48 aa EPKSRFAMLDDVKILAN), identical to the related rat and mouse sequences., Epitop: aa32-48, Specificit: Expressed principally in liver. Weakly expressed in kidney. ., Application: Western blot, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Thimerosal, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANGPTL: Uniprot: Q9Y5C1 NCBI: NM_014495 NP_055310.1
470.00 € 470.0 EUR
Goat anti‑Human APG12 / ATG12 IgG Polyclonal RW-C204269-600
Antibody: APG12 / ATG12 Goat anti-Human Polyclonal (N-Terminus) Antibody, Application: WB, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Cat, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Donkey, Format: Unconjugated, Unmodified, Descriptio: ATG12 antibody RW-C204269 is an unconjugated goat polyclonal antibody to ATG12 (APG12) (N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human APG12 / ATG12, Synonym: ATG12 | Autophagy-related protein 12 | APG12L | Autophagy related 12 | FBR93 | APG12 | APG12-like | Ubiquitin-like protein ATG12 | HAPG12, Hos: Goat, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Cat, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Donkey (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Purified recombinant peptide within residues 65 aa to the N-Terminus of human ATG12 produced in E. coli., Epitop: N-Terminus, Specificit: Detects GFP-ATG12 in transfected cells by Western blot., Application: Western blot (1:250 - 1:2000), Presentatio: PBS, 0.05% Sodium Azide, 20% Glycerol, Storag: Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About APG12 / ATG1: Uniprot: O94817 NCBI: NM_004707 NP_004698.3
422.00 € 422.0 EUR
Rabbit anti‑Human APBB1 / FE65 Polyclonal RW-C407896-10
Antibody: APBB1 / FE65 Rabbit anti-Human Polyclonal (aa21-56) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: FE65 antibody RW-C407896 is an unconjugated rabbit polyclonal antibody to FE65 (APBB1) (aa21-56) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human APBB1 / FE65, Synonym: APBB1 | FE65 | Adaptor protein FE65a2 | Protein Fe65 | Stat-like protein | MGC:9072 | RIR, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the N-Terminus of human FE65 (21-56 aa ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids., Epitop: aa21-56, Specificit: Highly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease. ., Application: IHC
IHC - Paraffin (0.5 - 1 µg/ml)
Western blot (0.1 - 0.5 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections., Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About APBB1 / FE6: Uniprot: O00213 NCBI: NM_001164 NP_001155.1
470.00 € 470.0 EUR
Rabbit anti‑Human ANXA5 / Annexin V Polyclonal RW-C354289-100
Antibody: ANXA5 / Annexin V Rabbit anti-Human Polyclonal (Internal) Antibody, Application: WB, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: Annexin V antibody RW-C354289 is an unconjugated rabbit polyclonal antibody to Annexin V (ANXA5) (Internal) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ANXA5 / Annexin V, Synonym: ANXA5 | ANX5 | Anchorin CII | Calphobindin I | CBP-I | ENX2 | PP4 | RPRGL3 | Lipocortin V | Thromboplastin inhibitor | VAC-alpha | Vascular anticoagulant-alpha | PAP-I | Annexin A5 | Annexin V | Annexin-5 | Endonexin II, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the central region of human Annexin A5., Epitop: Internal, Specificit: Recognizes endogenous levels of Annexin A5 protein., Application: Western blot (1:500 - 1:1000), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANXA5 / Annexin : Uniprot: P08758 NCBI: NM_001154 NP_001145.1
299.00 € 299.0 EUR
Rabbit anti‑Human ANXA5 / Annexin V IgG Polyclonal RW-C387986-100
Antibody: ANXA5 / Annexin V Rabbit anti-Human Polyclonal (aa88-102) Antibody, Application: IHC, IHC-P, ICC, WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: Annexin V antibody RW-C387986 is an unconjugated rabbit polyclonal antibody to Annexin V (ANXA5) (aa88-102) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IHC and WB., Targe: Human ANXA5 / Annexin V, Synonym: ANXA5 | ANX5 | Anchorin CII | Calphobindin I | CBP-I | ENX2 | PP4 | RPRGL3 | Lipocortin V | Thromboplastin inhibitor | VAC-alpha | Vascular anticoagulant-alpha | PAP-I | Annexin A5 | Annexin V | Annexin-5 | Endonexin II, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Predicte: Bat, Guinea pig (at least 90% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Amino acids 88-102 (SRLYDAYELKHALKG-human) were used as the immunogen for this Annexin V antibody. Percent identity by BLAST analysis: Human, Mouse, Rat, Ferret, Sheep, Cat, Bovine, Hamster, Rabbit, Horse, Pig, Platypus, Dog (100%); Bat, Elephant, Opossum, Guinea pig (93%); Xenopus (80%)., Epitop: aa88-102, Specificit: Human ANXA5 / Annexin V, Application: IHC
IHC - Paraffin (0.5 - 1 µg/ml)
ICC (0.5 - 1 µg/ml)
Western blot (0.5 - 1 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Annexin V is also know as endonnexin II (ENX2),or placental protein 4 (PP4). It is a member of the family of Ca (2+)-dependent phospholipid binding proteins, known as annexins. It bind to the phospholipids that are preferentially located on the cytosolic face of the plasma membrane. Annexin V has a relative molecular weight of about 35,000. The gene lies on mouse chromosome 3 in close linkage with the fibroblast growth factor 2 (basic) gene and is syntenic with other genes known to have orthologous counterparts on human chromosome 4q. The cDNA encoded a protein of 320 amino acid residues. A single mRNA, approximately 1.6 kb long, was found to be expressed in human cell lines and placenta. It is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade., Presentatio: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide/thimerosal., Reconstitutio: Reconstitute in 0.2ml sterile distilled water., Storag: Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANXA5 / Annexin : Uniprot: P08758 NCBI: NM_001154 NP_001145.1
575.00 € 575.0 EUR
Rabbit anti‑Human ANXA2 / Annexin A2 Polyclonal RW-C351821-100
Antibody: ANXA2 / Annexin A2 Rabbit anti-Human Polyclonal (Internal) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: Annexin A2 antibody RW-C351821 is an unconjugated rabbit polyclonal antibody to Annexin A2 (ANXA2) (Internal) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ANXA2 / Annexin A2, Synonym: ANXA2 | Annexin A2 | Annexin-2 | ANX2 | Calpactin I heavy chain | Chromobindin-8 | CAL1H | Calpactin I heavy polypeptide | Chromobindin 8 | LPC2 | LIP2 | Lipocortin II | p36 | LPC2D | PAP-IV | Protein I | Annexin II | ANX2L4 | Calpactin-1 heavy chain, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the central region of human Annexin A2., Epitop: Internal, Specificit: Recognizes endogenous levels of Annexin A2 protein., Application: Western blot (1:500 - 1:1000), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ANXA2 / Annexin A: Uniprot: P07355 NCBI: NM_001002858 NP_001002858.1
299.00 € 299.0 EUR
Rabbit anti‑Human APLP1 / APLP-1 Polyclonal RW-C407690-10
Antibody: APLP1 / APLP-1 Rabbit anti-Human Polyclonal (aa82-112) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Horse, Sheep, Format: Unconjugated, Unmodified, Descriptio: APLP-1 antibody RW-C407690 is an unconjugated rabbit polyclonal antibody to APLP-1 (APLP1) (aa82-112) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human APLP1 / APLP-1, Synonym: APLP1 | APLP-1 | APLP | Amyloid-like protein 1, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Horse, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the N-Terminus of human APLP1 (82-112 aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids., Epitop: aa82-112, Specificit: Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD). ., Application: IHC
IHC - Paraffin (0.5 - 1 µg/ml)
Western blot (0.1 - 0.5 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections., Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About APLP1 / APLP-: Uniprot: P51693 NCBI: NM_005166 NP_005157.1
470.00 € 470.0 EUR
Rabbit anti‑Human APG5 / ATG5 Polyclonal RW-C313356-10
Antibody: APG5 / ATG5 Rabbit anti-Human Polyclonal (aa82-97) Antibody, Application: WB, Reactivity: Human, Monkey, Mouse, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Unconjugated, Unmodified, Descriptio: ATG5 antibody RW-C313356 is an unconjugated rabbit polyclonal antibody to ATG5 (APG5) (aa82-97) from human. It is reactive with human, mouse, bat and other species. Validated for WB., Targe: Human APG5 / ATG5, Synonym: ATG5 | APG5 | APG5-LIKE | APG5L | Apoptosis specific protein | Apoptosis-specific protein | Autophagy related 5 | HAPG5 | ASP | Autophagy protein 5, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence in the middle region of human APG5L(82-97 aa DRFDQFWAINRKLMEY), identical to the related mouse sequence, and different from the related rat sequence by one amino acid., Epitop: aa82-97, Specificit: Ubiquitous. The mRNA is present at similar levels in viable and apoptotic cells, whereas the protein is dramatically highly expressed in apoptotic cells., Application: Western blot, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Thimerosal, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About APG5 / ATG: Uniprot: Q9H1Y0 NCBI: NM_004849 NP_004840.1
470.00 € 470.0 EUR
Mouse anti‑Human ARG1 / Arginase 1 IgG1 Monoclonal RW-C663086-100
Antibody: ARG1 / Arginase 1 Mouse anti-Human Monoclonal Antibody, Application: WB, Flo, RIA, Reactivity: Human, Sheep, Format: Unconjugated, Unmodified, Descriptio: Arginase 1 antibody RW-C663086 is an unconjugated mouse monoclonal antibody to Arginase 1 (ARG1) from human. It is reactive with human and sheep. Validated for Flow, RIA and WB., Targe: Human ARG1 / Arginase 1, Synonym: ARG1 | Arginase, liver | Arginase 1 | Liver-type arginase | Liver arginase | Arginase-1 | Type I arginase, Hos: Mouse, Reactivit: Human, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG1 Monoclonal, Conjugation: Unconjugated, Purificatio: 0.2 Micron Filter, Modification: Unmodified, Immunoge: Peptide D14967-1-1t/m6, Application: Western blot
Flow Cytometry
Radioimmunoassay, Usag: W: A reduced sample treatment and SDS-Page was used. The band size is 40 kDa IA: clone D1.2 can be used as a coat antibody in immune assay setting FC: 2 ug of antibody D1.2 stains intracellular Arginase 1. For intracellular staining 250,000 cells were permeabilized with buffer containing 0.1% Saponin. The HepG2 cells were fixed in 4% paraformaldehyde before staining., Storag: Store at 4°C for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARG1 / Arginase : Uniprot: P05089 NCBI: NM_000045 NP_000036.2
554.00 € 554.0 EUR
Rabbit anti‑Human ARFL3 / ARL3 Polyclonal RW-C466569-100
Antibody: ARFL3 / ARL3 Rabbit anti-Human Polyclonal (aa71-120) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ARL3 antibody RW-C466569 is an HRP-conjugated rabbit polyclonal antibody to ARL3 (ARFL3) (aa71-120) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARFL3 / ARL3, Synonym: ARL3 | ARFL3 | ARF-like 3 | ADP-ribosylation factor-like 3, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa71-120 of human ARL3 (P36405, NP_004302). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus, Catfish, Stickleback, Zebrafish (100%); Drosophila (81%)., Epitop: aa71-120, Specificit: Human ARL3, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARFL3 / ARL: Uniprot: P36405 NCBI: NM_004311 NP_004302.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARFL3 / ARL3 Polyclonal RW-C466567-100
Antibody: ARFL3 / ARL3 Rabbit anti-Human Polyclonal (aa71-120) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ARL3 antibody RW-C466567 is a biotin-conjugated rabbit polyclonal antibody to ARL3 (ARFL3) (aa71-120) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARFL3 / ARL3, Synonym: ARL3 | ARFL3 | ARF-like 3 | ADP-ribosylation factor-like 3, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa71-120 of human ARL3 (P36405, NP_004302). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus, Catfish, Stickleback, Zebrafish (100%); Drosophila (81%)., Epitop: aa71-120, Specificit: Human ARL3, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARFL3 / ARL: Uniprot: P36405 NCBI: NM_004311 NP_004302.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARFL3 / ARL3 Polyclonal RW-C466568-100
Antibody: ARFL3 / ARL3 Rabbit anti-Human Polyclonal (aa71-120) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ARL3 antibody RW-C466568 is an FITC-conjugated rabbit polyclonal antibody to ARL3 (ARFL3) (aa71-120) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARFL3 / ARL3, Synonym: ARL3 | ARFL3 | ARF-like 3 | ADP-ribosylation factor-like 3, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa71-120 of human ARL3 (P36405, NP_004302). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus, Catfish, Stickleback, Zebrafish (100%); Drosophila (81%)., Epitop: aa71-120, Specificit: Human ARL3, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARFL3 / ARL: Uniprot: P36405 NCBI: NM_004311 NP_004302.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARFIP2 / Arfaptin 2 Polyclonal RW-C458602-100
Antibody: ARFIP2 / Arfaptin 2 Rabbit anti-Human Polyclonal (aa21-70) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated FITC Biotin, Descriptio: Arfaptin 2 antibody RW-C458602 is an HRP-conjugated rabbit polyclonal antibody to Arfaptin 2 (ARFIP2) (aa21-70) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARFIP2 / Arfaptin 2, Synonym: ARFIP2 | Arfaptin-2 | Partner of RAC1 | POR1 | Arfaptin 2 | Partner of RAC1 (arfaptin 2) | Protein POR1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with FITC, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa21-70 of human ARFIP2 (P53365-2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Salmon, Zebrafish (100%); Monkey, Xenopus, Stickleback (92%); Sea squirt (85%)., Epitop: aa21-70, Specificit: Human ARFIP2 / Arfaptin 2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARFIP2 / Arfaptin : Uniprot: P53365 NCBI: NM_012402 NP_036534.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARFIP2 / Arfaptin 2 Polyclonal RW-C458599-100
Antibody: ARFIP2 / Arfaptin 2 Rabbit anti-Human Polyclonal (aa21-70) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: Arfaptin 2 antibody RW-C458599 is a biotin-conjugated rabbit polyclonal antibody to Arfaptin 2 (ARFIP2) (aa21-70) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARFIP2 / Arfaptin 2, Synonym: ARFIP2 | Arfaptin-2 | Partner of RAC1 | POR1 | Arfaptin 2 | Partner of RAC1 (arfaptin 2) | Protein POR1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa21-70 of human ARFIP2 (P53365-2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Salmon, Zebrafish (100%); Monkey, Xenopus, Stickleback (92%); Sea squirt (85%)., Epitop: aa21-70, Specificit: Human ARFIP2 / Arfaptin 2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARFIP2 / Arfaptin : Uniprot: P53365 NCBI: NM_012402 NP_036534.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARFIP2 / Arfaptin 2 Polyclonal RW-C458598-100
Antibody: ARFIP2 / Arfaptin 2 Rabbit anti-Human Polyclonal (aa21-70) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: Arfaptin 2 antibody RW-C458598 is an FITC-conjugated rabbit polyclonal antibody to Arfaptin 2 (ARFIP2) (aa21-70) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARFIP2 / Arfaptin 2, Synonym: ARFIP2 | Arfaptin-2 | Partner of RAC1 | POR1 | Arfaptin 2 | Partner of RAC1 (arfaptin 2) | Protein POR1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa21-70 of human ARFIP2 (P53365-2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Salmon, Zebrafish (100%); Monkey, Xenopus, Stickleback (92%); Sea squirt (85%)., Epitop: aa21-70, Specificit: Human ARFIP2 / Arfaptin 2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARFIP2 / Arfaptin : Uniprot: P53365 NCBI: NM_012402 NP_036534.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARFIP2 / Arfaptin 2 Polyclonal RW-C429052-100
Antibody: ARFIP2 / Arfaptin 2 Rabbit anti-Human Polyclonal (aa26-75) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: Arfaptin 2 antibody RW-C429052 is an HRP-conjugated rabbit polyclonal antibody to Arfaptin 2 (ARFIP2) (aa26-75) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARFIP2 / Arfaptin 2, Synonym: ARFIP2 | Arfaptin-2 | Partner of RAC1 | POR1 | Arfaptin 2 | Partner of RAC1 (arfaptin 2) | Protein POR1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa26-75 of human ARFIP2 (P53365, NP_036534). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Guinea pig (100%); Platypus (84%)., Epitop: aa26-75, Specificit: Human ARFIP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARFIP2 / Arfaptin : Uniprot: P53365 NCBI: NM_012402 NP_036534.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARFIP2 / Arfaptin 2 Polyclonal RW-C429050-100
Antibody: ARFIP2 / Arfaptin 2 Rabbit anti-Human Polyclonal (aa26-75) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: Arfaptin 2 antibody RW-C429050 is an FITC-conjugated rabbit polyclonal antibody to Arfaptin 2 (ARFIP2) (aa26-75) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARFIP2 / Arfaptin 2, Synonym: ARFIP2 | Arfaptin-2 | Partner of RAC1 | POR1 | Arfaptin 2 | Partner of RAC1 (arfaptin 2) | Protein POR1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa26-75 of human ARFIP2 (P53365, NP_036534). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Guinea pig (100%); Platypus (84%)., Epitop: aa26-75, Specificit: Human ARFIP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARFIP2 / Arfaptin : Uniprot: P53365 NCBI: NM_012402 NP_036534.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARFIP2 / Arfaptin 2 Polyclonal RW-C429049-100
Antibody: ARFIP2 / Arfaptin 2 Rabbit anti-Human Polyclonal (aa26-75) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: Arfaptin 2 antibody RW-C429049 is a biotin-conjugated rabbit polyclonal antibody to Arfaptin 2 (ARFIP2) (aa26-75) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARFIP2 / Arfaptin 2, Synonym: ARFIP2 | Arfaptin-2 | Partner of RAC1 | POR1 | Arfaptin 2 | Partner of RAC1 (arfaptin 2) | Protein POR1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa26-75 of human ARFIP2 (P53365, NP_036534). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Guinea pig (100%); Platypus (84%)., Epitop: aa26-75, Specificit: Human ARFIP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARFIP2 / Arfaptin : Uniprot: P53365 NCBI: NM_012402 NP_036534.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF6 Polyclonal RW-C479351-100
Antibody: ARF6 Rabbit anti-Human Polyclonal (C-Terminus) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Xenopus, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ARF6 antibody RW-C479351 is an HRP-conjugated rabbit polyclonal antibody to ARF6 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARF6, Synonym: ARF6 | ADP-ribosylation factor 6, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ARF6 (Q6FH17). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Mouse, Rat, Ferret, Sheep, Elephant, Panda, Bovine, Bat, Rabbit, Horse, Pig, Guinea pig, Platypus, Lizard, Xenopus, Pufferfish (100%)., Epitop: C-Terminus, Specificit: Human ARF6, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P62330 NCBI: NM_001663 NP_001654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF6 Polyclonal RW-C479350-100
Antibody: ARF6 Rabbit anti-Human Polyclonal (C-Terminus) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Xenopus, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ARF6 antibody RW-C479350 is an FITC-conjugated rabbit polyclonal antibody to ARF6 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARF6, Synonym: ARF6 | ADP-ribosylation factor 6, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ARF6 (Q6FH17). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Mouse, Rat, Ferret, Sheep, Elephant, Panda, Bovine, Bat, Rabbit, Horse, Pig, Guinea pig, Platypus, Lizard, Xenopus, Pufferfish (100%)., Epitop: C-Terminus, Specificit: Human ARF6, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P62330 NCBI: NM_001663 NP_001654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF6 Polyclonal RW-C479349-100
Antibody: ARF6 Rabbit anti-Human Polyclonal (C-Terminus) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Xenopus, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ARF6 antibody RW-C479349 is a biotin-conjugated rabbit polyclonal antibody to ARF6 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARF6, Synonym: ARF6 | ADP-ribosylation factor 6, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ARF6 (Q6FH17). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Mouse, Rat, Ferret, Sheep, Elephant, Panda, Bovine, Bat, Rabbit, Horse, Pig, Guinea pig, Platypus, Lizard, Xenopus, Pufferfish (100%)., Epitop: C-Terminus, Specificit: Human ARF6, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P62330 NCBI: NM_001663 NP_001654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF6 IgG Polyclonal RW-C458821-100
Antibody: ARF6 Rabbit anti-Human Polyclonal (C-Terminus) (Biotin) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila, Format: Biotin, Unmodified, Other formats: FITC HRP Unconjugated, Descriptio: ARF6 antibody RW-C458821 is a biotin-conjugated rabbit polyclonal antibody to ARF6 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ARF6, Synonym: ARF6 | ADP-ribosylation factor 6, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ARF6 (P62330, NP_001654). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus, Catfish, Salmon, Smelt, Zebrafish, Drosophila, Beetle (100%)., Epitop: C-Terminus, Specificit: Human ARF6, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P62330 NCBI: NM_001663 NP_001654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF6 IgG Polyclonal RW-C458273-100
Antibody: ARF6 Rabbit anti-Human Polyclonal (C-Terminus) (FITC) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila, Format: FITC, Unmodified, Other formats: HRP Biotin Unconjugated, Descriptio: ARF6 antibody RW-C458273 is an FITC-conjugated rabbit polyclonal antibody to ARF6 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ARF6, Synonym: ARF6 | ADP-ribosylation factor 6, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with HRP, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ARF6 (P62330, NP_001654). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus, Catfish, Salmon, Smelt, Zebrafish, Drosophila, Beetle (100%)., Epitop: C-Terminus, Specificit: Human ARF6, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P62330 NCBI: NM_001663 NP_001654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF6 IgG Polyclonal RW-C458274-100
Antibody: ARF6 Rabbit anti-Human Polyclonal (C-Terminus) (HRP) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila, Format: Horseradish Peroxidase, Unmodified, Other formats: FITC Biotin Unconjugated, Descriptio: ARF6 antibody RW-C458274 is an HRP-conjugated rabbit polyclonal antibody to ARF6 (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ARF6, Synonym: ARF6 | ADP-ribosylation factor 6, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Drosophila (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with FITC, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from C-Terminus of human ARF6 (P62330, NP_001654). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus, Catfish, Salmon, Smelt, Zebrafish, Drosophila, Beetle (100%)., Epitop: C-Terminus, Specificit: Human ARF6, Application: IHC
IHC - Paraffin
Western blot
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P62330 NCBI: NM_001663 NP_001654.1
469.00 € 469.0 EUR
Goat anti‑Human ARF4 Polyclonal RW-B9560-50
Antibody: ARF4 Goat anti-Human Polyclonal (aa137-150) Antibody, Application: IHC, IHC-P, WB, Peptide-ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: ARF4 antibody RW-B9560 is an unconjugated goat polyclonal antibody to ARF4 (aa137-150) from human. It is reactive with human, mouse, rat and other species. Validated for IHC, Peptide-ELISA and WB. Tested on 20 paraffin-embedded human tissues., Targe: Human ARF4, Synonym: ARF4 | ARF2 | ADP-ribosylation factor 2 | ADP-ribosylation factor 4, Hos: Goat, Reactivit: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide., Modification: Unmodified, Immunoge: Peptide with sequence C-SEMTDKLGLQSLRN, from the internal region of the protein sequence according to NP_001651.1., Epitop: aa137-150, Specificit: Human ARF4., Application: IHC
IHC - Paraffin (5 µg/ml)
Western blot (0.3 - 1 µg/ml)
Peptide Enzyme-Linked Immunosorbent Assay (1:128000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Peptide ELISA: antibody detection limit dilution 1:128000. Western blot: Approx 19kD band observed in lysates of cell line HeLa (calculated MW of 20.5kD according to NP_001651.1). Recommended concentration: 0.3-1 ug/ml., Presentatio: TBS, pH 7.3, 0.02% Sodium Azide, 0.5% BSA, Storag: Aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P18085 NCBI: NM_001660 NP_001651.1
485.00 € 485.0 EUR
Goat anti‑Human ARF1/2/3/4 Polyclonal RW-C54527-100
Antibody: ARF1/2/3/4 Goat anti-Human Polyclonal (C-Terminus) Antibody, Application: WB, Peptide-ELISA, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Sheep, Chicken, Xenopus, Format: Unconjugated, Unmodified, Descriptio: 3 antibody RW-C54527 is an unconjugated goat polyclonal antibody to 3 (ARF1 / 2) (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for Peptide-ELISA and WB., Targe: Human ARF1/2/3/4, Synonym: ARF1/ARF2/ARF3/ARF4, Hos: Goat, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide., Modification: Unmodified, Immunoge: Peptide with sequence C-EGLDWLSNQLRNQK, from the C-Terminus of protein sequence according to NP_001019397.1NP_001649.1NP_001019398.1NP_001019399.1., Epitop: C-Terminus, Specificit: Human ADP Ribosylation Factor (ARF1/ARF2/ARF3/ARF4). This antibody is expected to recognize all four reported isoforms., Application: Western blot (1 - 3 µg/ml)
Peptide Enzyme-Linked Immunosorbent Assay (1:8000), Presentatio: TBS, pH 7.3, 0.02% Sodium Azide, 0.5% BSA, Storag: Aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee.
503.00 € 503.0 EUR
Rabbit anti‑Human ARF1 IgG Polyclonal RW-C450842-100
Antibody: ARF1 Rabbit anti-Human Polyclonal (aa108-157) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ARF1 antibody RW-C450842 is an FITC-conjugated rabbit polyclonal antibody to ARF1 (aa108-157) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARF1, Synonym: ARF1 | ADP-ribosylation factor 1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa108-157 of human ARF1 (P61204, NP_001649). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Chicken, Lizard, Xenopus, Trout, Salmon, Stickleback, Pufferfish, Zebrafish (100%); Drosophila, Rice, Beetle, Grape, Arabidopsis (92%)., Epitop: aa108-157, Specificit: Human ARF1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P84077 NCBI: NM_001658 NP_001649.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF1 IgG Polyclonal RW-C450843-100
Antibody: ARF1 Rabbit anti-Human Polyclonal (aa108-157) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ARF1 antibody RW-C450843 is an HRP-conjugated rabbit polyclonal antibody to ARF1 (aa108-157) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARF1, Synonym: ARF1 | ADP-ribosylation factor 1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa108-157 of human ARF1 (P61204, NP_001649). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Chicken, Lizard, Xenopus, Trout, Salmon, Stickleback, Pufferfish, Zebrafish (100%); Drosophila, Rice, Beetle, Grape, Arabidopsis (92%)., Epitop: aa108-157, Specificit: Human ARF1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P84077 NCBI: NM_001658 NP_001649.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF1 IgG Polyclonal RW-C450841-100
Antibody: ARF1 Rabbit anti-Human Polyclonal (aa108-157) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ARF1 antibody RW-C450841 is a biotin-conjugated rabbit polyclonal antibody to ARF1 (aa108-157) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARF1, Synonym: ARF1 | ADP-ribosylation factor 1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa108-157 of human ARF1 (P61204, NP_001649). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Chicken, Lizard, Xenopus, Trout, Salmon, Stickleback, Pufferfish, Zebrafish (100%); Drosophila, Rice, Beetle, Grape, Arabidopsis (92%)., Epitop: aa108-157, Specificit: Human ARF1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P84077 NCBI: NM_001658 NP_001649.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF1 Polyclonal RW-C450840-100
Antibody: ARF1 Rabbit anti-Human Polyclonal (aa73-122) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ARF1 antibody RW-C450840 is an HRP-conjugated rabbit polyclonal antibody to ARF1 (aa73-122) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARF1, Synonym: ARF1 | ADP-ribosylation factor 1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa73-122 of human ARF1 (P84077, NP_001649). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus, Trout, Salmon, Sablefish, Stickleback, Pufferfish, Zebrafish (100%); Drosophila, Rice, Nematode (92%); Slime mold, Beetle (85%)., Epitop: aa73-122, Specificit: Human ARF1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P84077 NCBI: NM_001658 NP_001649.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF1 Polyclonal RW-C450839-100
Antibody: ARF1 Rabbit anti-Human Polyclonal (aa73-122) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ARF1 antibody RW-C450839 is an FITC-conjugated rabbit polyclonal antibody to ARF1 (aa73-122) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARF1, Synonym: ARF1 | ADP-ribosylation factor 1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa73-122 of human ARF1 (P84077, NP_001649). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus, Trout, Salmon, Sablefish, Stickleback, Pufferfish, Zebrafish (100%); Drosophila, Rice, Nematode (92%); Slime mold, Beetle (85%)., Epitop: aa73-122, Specificit: Human ARF1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P84077 NCBI: NM_001658 NP_001649.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARF1 Polyclonal RW-C450838-100
Antibody: ARF1 Rabbit anti-Human Polyclonal (aa73-122) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ARF1 antibody RW-C450838 is a biotin-conjugated rabbit polyclonal antibody to ARF1 (aa73-122) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARF1, Synonym: ARF1 | ADP-ribosylation factor 1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa73-122 of human ARF1 (P84077, NP_001649). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus, Trout, Salmon, Sablefish, Stickleback, Pufferfish, Zebrafish (100%); Drosophila, Rice, Nematode (92%); Slime mold, Beetle (85%)., Epitop: aa73-122, Specificit: Human ARF1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARF: Uniprot: P84077 NCBI: NM_001658 NP_001649.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARAF / ARAF1 / A-RAF Polyclonal RW-C351844-100
Antibody: ARAF / ARAF1 / A-RAF Rabbit anti-Human Polyclonal (pTyr302) Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Bovine, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: A-RAF antibody RW-C351844 is an unconjugated rabbit polyclonal antibody to A-RAF (ARAF / ARAF1) (pTyr302) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARAF / ARAF1 / A-RAF, Synonym: ARAF | A RAF | A-RAF | A-raf-1 | PKS | PKS2 | Proto-oncogene A-Raf | Proto-oncogene A-Raf-1 | Ras-binding protein DA-Raf | Oncogene ARAF1 | ARAF1 | Proto-oncogene Pks | RAFA1, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the central region of human A-RAF., Epitop: pTyr302, Specificit: Recognizes endogenous levels of A-RAF (pY302) protein., Application: Western blot (1:500 - 1:1000), Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARAF / ARAF1 / A-RA: Uniprot: P10398 NCBI: NM_001654 NP_001645.1
315.00 € 315.0 EUR
Rabbit anti‑Human ARAF / ARAF1 / A-RAF IgG Polyclonal RW-C458798-100
Antibody: ARAF / ARAF1 / A-RAF Rabbit anti-Human Polyclonal (aa254-303) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Mouse, Rat, Bat, Bovine, Horse, Pig, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: A-RAF antibody RW-C458798 is an HRP-conjugated rabbit polyclonal antibody to A-RAF (ARAF / ARAF1) (aa254-303) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARAF / ARAF1 / A-RAF, Synonym: ARAF | A RAF | A-RAF | A-raf-1 | PKS | PKS2 | Proto-oncogene A-Raf | Proto-oncogene A-Raf-1 | Ras-binding protein DA-Raf | Oncogene ARAF1 | ARAF1 | Proto-oncogene Pks | RAFA1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Mouse, Rat, Bat, Bovine, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa254-303 of human ARAF (P10398, NP_001645). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Mouse, Rat, Sheep, Bovine, Bat, Horse, Pig (100%); Marmoset, Dog, Rabbit (92%); Elephant (85%)., Epitop: aa254-303, Specificit: Human ARAF, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARAF / ARAF1 / A-RA: Uniprot: P10398 NCBI: NM_001654 NP_001645.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARAF / ARAF1 / A-RAF IgG Polyclonal RW-C458797-100
Antibody: ARAF / ARAF1 / A-RAF Rabbit anti-Human Polyclonal (aa254-303) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Mouse, Rat, Bat, Bovine, Horse, Pig, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: A-RAF antibody RW-C458797 is an FITC-conjugated rabbit polyclonal antibody to A-RAF (ARAF / ARAF1) (aa254-303) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARAF / ARAF1 / A-RAF, Synonym: ARAF | A RAF | A-RAF | A-raf-1 | PKS | PKS2 | Proto-oncogene A-Raf | Proto-oncogene A-Raf-1 | Ras-binding protein DA-Raf | Oncogene ARAF1 | ARAF1 | Proto-oncogene Pks | RAFA1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Mouse, Rat, Bat, Bovine, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa254-303 of human ARAF (P10398, NP_001645). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Mouse, Rat, Sheep, Bovine, Bat, Horse, Pig (100%); Marmoset, Dog, Rabbit (92%); Elephant (85%)., Epitop: aa254-303, Specificit: Human ARAF, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARAF / ARAF1 / A-RA: Uniprot: P10398 NCBI: NM_001654 NP_001645.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARAF / ARAF1 / A-RAF IgG Polyclonal RW-C458796-100
Antibody: ARAF / ARAF1 / A-RAF Rabbit anti-Human Polyclonal (aa254-303) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Mouse, Rat, Bat, Bovine, Horse, Pig, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: A-RAF antibody RW-C458796 is a biotin-conjugated rabbit polyclonal antibody to A-RAF (ARAF / ARAF1) (aa254-303) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARAF / ARAF1 / A-RAF, Synonym: ARAF | A RAF | A-RAF | A-raf-1 | PKS | PKS2 | Proto-oncogene A-Raf | Proto-oncogene A-Raf-1 | Ras-binding protein DA-Raf | Oncogene ARAF1 | ARAF1 | Proto-oncogene Pks | RAFA1, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Mouse, Rat, Bat, Bovine, Horse, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa254-303 of human ARAF (P10398, NP_001645). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Mouse, Rat, Sheep, Bovine, Bat, Horse, Pig (100%); Marmoset, Dog, Rabbit (92%); Elephant (85%)., Epitop: aa254-303, Specificit: Human ARAF, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARAF / ARAF1 / A-RA: Uniprot: P10398 NCBI: NM_001654 NP_001645.1
469.00 € 469.0 EUR
Rabbit anti‑Human AQP3 / Aquaporin 3 Polyclonal RW-C353898-100
Antibody: AQP3 / Aquaporin 3 Rabbit anti-Human Polyclonal (Internal) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Monkey, Mouse, Rat, Bovine, Pig, Sheep, Zebrafish, Format: Unconjugated, Unmodified, Descriptio: Aquaporin 3 antibody RW-C353898 is an unconjugated rabbit polyclonal antibody to Aquaporin 3 (AQP3) (Internal) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AQP3 / Aquaporin 3, Synonym: AQP3 | Aquaporin 3 (GIL blood group) | Aquaglyceroporin-3 | AQP-3 | Aquaporin 3 | Aquaporin 3 (Gill blood group) | Aquaporin-3 | GIL, Hos: Rabbit, Reactivit: Human, Monkey, Mouse, Rat, Bovine, Pig, Sheep, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the central region of human Aquaporin 3., Epitop: Internal, Specificit: Recognizes endogenous levels of Aquaporin 3 protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AQP3 / Aquaporin : Uniprot: Q92482 NCBI: NM_004925 NP_004916.1
299.00 € 299.0 EUR
Rabbit anti‑Human AQP2 / Aquaporin 2 Polyclonal RW-B14083-50
Antibody: AQP2 / Aquaporin 2 Rabbit anti-Human Polyclonal (C-Terminus) Antibody, Application: IHC, IHC-P, ICC, IF, WB, Reactivity: Human, Mouse, Rat, Bovine, Dog, Pig, Sheep, Format: Unconjugated, Unmodified, Descriptio: Aquaporin 2 antibody RW-B14083 is an unconjugated rabbit polyclonal antibody to Aquaporin 2 (AQP2) (C-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IF, IHC and WB. Tested on 20 paraffin-embedded human tissues., Targe: Human AQP2 / Aquaporin 2, Synonym: AQP2 | AQP-CD | ADH water channel | Aquaporin 2 (collecting duct) | AQP-2 | Aquaporin 2 | Aquaporin-CD | Aquaporin-2 | Water-channel aquaporin 2 | WCH-CD, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Dog, Pig, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: KLH-conjugated synthetic peptide encompassing a sequence within the C-Terminus of human Aquaporin 2., Epitop: C-Terminus, Specificit: Recognizes endogenous levels of Aquaporin 2 protein., Application: IHC
IHC - Paraffin (1:100 - 1:200)
ICC (1:100 - 1:500)
Immunofluorescence
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.01% Sodium Azide, 30% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AQP2 / Aquaporin : Uniprot: P41181 NCBI: NM_000486 NP_000477.1
460.00 € 460.0 EUR
Rabbit anti‑Mouse AQP2 / Aquaporin 2 IgG Polyclonal RW-C3800-50
Antibody: AQP2 / Aquaporin 2 Rabbit anti-Mouse Polyclonal (N-Terminus) Antibody, Application: WB, ELISA, Reactivity: Mouse, Human, Rat, Sheep, Format: Unconjugated, Unmodified, Descriptio: Aquaporin 2 antibody RW-C3800 is an unconjugated rabbit polyclonal antibody to Aquaporin 2 (AQP2) (N-Terminus) from mouse. It is reactive with human, mouse, rat and other species. Validated for ELISA and WB., Targe: Mouse AQP2 / Aquaporin 2, Synonym: AQP2 | AQP-CD | ADH water channel | Aquaporin 2 (collecting duct) | AQP-2 | Aquaporin 2 | Aquaporin-CD | Aquaporin-2 | Water-channel aquaporin 2 | WCH-CD, Hos: Rabbit, Reactivit: Mouse, Human, Rat, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: A 19 aa synthetic peptide sequence corresponding to the N-Terminus, extracellular domain of mouse AQP2. (KLH)., Epitop: N-Terminus, Specificit: Recognizes mouse AQP2 at ~30kD. Species sequence Homology: Rat-100%, sheep-78%, human AQP2-73%., Application: Western blot (1 - 10 µg/ml)
ELISA (0.5 - 1 µg/ml), Usag: Suitable for use in ELISA and Western Blot., Presentatio: PBS, pH 7.2, 0.1% BSA, Storag: Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AQP2 / Aquaporin : Uniprot: P41181 NCBI: NM_000486 NP_000477.1
832.00 € 832.0 EUR
Rabbit anti‑Human AQP1 / Aquaporin 1 Polyclonal RW-C659109-100
Antibody: AQP1 / Aquaporin 1 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Dog, Sheep, Format: Unconjugated, Unmodified, Descriptio: Aquaporin 1 antibody RW-C659109 is an unconjugated rabbit polyclonal antibody to Aquaporin 1 (AQP1) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human AQP1 / Aquaporin 1, Synonym: AQP1 | Aquaporin-1 | AQP-1 | AQP-CHIP | Aquaporin 1 | Aquaporin-CHIP | CHIP28 | Colton blood group | Urine water channel | CO, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Dog, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Purified, Modification: Unmodified, Application: Western blot, Presentatio: PBS (without Mg2+, Ca2+), pH 7.4, 150 mM NaCl, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AQP1 / Aquaporin : Uniprot: P29972 NCBI: NM_198098 NP_932766.1
386.00 € 386.0 EUR
Rabbit anti‑Human AQP1 / Aquaporin 1 Polyclonal RW-C407687-10
Antibody: AQP1 / Aquaporin 1 Rabbit anti-Human Polyclonal (aa240-269) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Sheep, Format: Unconjugated, Unmodified, Descriptio: Aquaporin 1 antibody RW-C407687 is an unconjugated rabbit polyclonal antibody to Aquaporin 1 (AQP1) (aa240-269) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AQP1 / Aquaporin 1, Synonym: AQP1 | Aquaporin-1 | AQP-1 | AQP-CHIP | Aquaporin 1 | Aquaporin-CHIP | CHIP28 | Colton blood group | Urine water channel | CO, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the C-Terminus of human Aquaporin 1 (240-269 aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid., Epitop: aa240-269, Specificit: Detected in erythrocytes (at protein level). Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver. ., Application: IHC
IHC - Paraffin (0.5 - 1 µg/ml)
Western blot (0.1 - 0.5 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections., Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AQP1 / Aquaporin : Uniprot: P29972 NCBI: NM_198098 NP_932766.1
470.00 € 470.0 EUR
Rabbit anti‑Human AQP1 / Aquaporin 1 IgG Polyclonal RW-C3816-50
Antibody: AQP1 / Aquaporin 1 Rabbit anti-Human Polyclonal (aa243-261) (Biotin) Antibody, Application: IHC, WB, Reactivity: Human, Mouse, Rat, Bovine, Sheep, Format: Biotin, Unmodified, Descriptio: Aquaporin 1 antibody RW-C3816 is a biotin-conjugated rabbit polyclonal antibody to Aquaporin 1 (AQP1) (aa243-261) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AQP1 / Aquaporin 1, Synonym: AQP1 | Aquaporin-1 | AQP-1 | AQP-CHIP | Aquaporin 1 | Aquaporin-CHIP | CHIP28 | Colton blood group | Urine water channel | CO, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin, Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide corresponding to aa243-261 of human AQP1 (KVWTS GQVEE YDLDA DDIN). SwissProt accession number P29972. Epitope location: Intracellular, C-Terminus., Epitop: aa243-261, Specificit: Recognizes Aquaporin 1. Species cross-reactivity: Rat and human. Species sequence Homology: Rat, mouse, bovine, sheep: 100%; Canine: 18/19; Frog (Rana esculenta), toad (Bufo marinus): 14/19., Application: IHC
Western blot (1:400 - 1:800), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Suitable for use in Western Blot and Immunohistochemistry. Western Blot (Rat kidney membranes): 1:400-1:800. Immunohistochemistry: Rat kidney sections. The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, pH 7.2. No preservative added. No stabilizing proteins added. Glycerol free., Storag: Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AQP1 / Aquaporin : Uniprot: P29972 NCBI: NM_198098 NP_932766.1
1,054.00 € 1054.0 EUR
Rabbit anti‑Human AQP1 / Aquaporin 1 IgG Polyclonal RW-C3815-50
Antibody: AQP1 / Aquaporin 1 Rabbit anti-Human Polyclonal (aa243-261) Antibody, Application: IHC, WB, Reactivity: Human, Mouse, Rat, Bovine, Sheep, Format: Unconjugated, Unmodified, Descriptio: Aquaporin 1 antibody RW-C3815 is an unconjugated rabbit polyclonal antibody to Aquaporin 1 (AQP1) (aa243-261) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human AQP1 / Aquaporin 1, Synonym: AQP1 | Aquaporin-1 | AQP-1 | AQP-CHIP | Aquaporin 1 | Aquaporin-CHIP | CHIP28 | Colton blood group | Urine water channel | CO, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic peptide corresponding to aa243-261 of human AQP1 (KVWTS GQVEE YDLDA DDIN). SwissProt accession number P29972. Epitope location: Intracellular, C-Terminus., Epitop: aa243-261, Specificit: Recognizes Aquaporin 1. Species cross-reactivity: Rat and human. Species sequence Homology: Rat, mouse, bovine, sheep: 100%; Canine: 18/19; Frog (Rana esculenta), toad (Bufo marinus): 14/19., Application: IHC
Western blot (1:400 - 1:800), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Suitable for use in Western Blot and Immunohistochemistry. Western Blot (Rat kidney membranes): 1:400-1:800. Immunohistochemistry: Rat kidney sections., Presentatio: PBS, pH 7.2. No preservative added. No stabilizing proteins added. Glycerol free., Storag: Store at 4°C. Avoid freezing., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AQP1 / Aquaporin : Uniprot: P29972 NCBI: NM_198098 NP_932766.1
1,054.00 € 1054.0 EUR
Rabbit anti‑Human APP / Beta Amyloid Precursor IgG Polyclonal RW-C209352-50
Antibody: APP / Beta Amyloid Precursor Rabbit anti-Human Polyclonal (Pyro-Glu3) Antibody, Application: IHC, IF, WB, ELISA, Reactivity: Human, Bovine, Sheep, Primate, Format: Unconjugated, Unmodified, Descriptio: Beta Amyloid Precursor antibody RW-C209352 is an unconjugated rabbit polyclonal antibody to Beta Amyloid Precursor (APP) (Pyro-Glu3) from human. It is reactive with human, bovine, primate and other species. Validated for ELISA, IF, IHC and WB., Targe: Human APP / Beta Amyloid Precursor, Synonym: APP | ABPP | A4 | ABETA | AD1 | Alzheimer disease | Amyloid beta | Beta-amyloid peptide | APPI | Beta amyloid | CVAP | AAA | PN2 | PreA4 | Amyloid beta A4 protein | Peptidase nexin-II | CTFgamma | PN-II | Protease nexin-II, Hos: Rabbit, Reactivit: Human, Bovine, Sheep, Primate (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Beta Amyloid [Pyro Glu3] affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the N-Terminus 3-pyro E start point of human beta Amyloid., Epitop: Pyro-Glu3, Specificit: This antibody contains no reactivity towards the 1-42 ABeta peptide. A BLAST analysis was used to suggest cross-reactivity with Human, Primate, Bovine and Sheep based on 100% sequence homology. It is not reactive with Rodentia. Cross-reactivity with beta Amyloid pyro Glu3 from other sources has not been determined., Application: IHC (1:100 - 1:500)
Immunofluorescence (1:100 - 1:500)
Western blot (1 µg/ml)
ELISA (1:20000 - 1:60000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Anti-Beta Amyloid pyro Glu3 antibody is useful for ELISA, Western Blot and Immunostaining. Expect a band approximately ~86.9kD corresponding to the appropriate cell lysate or extract., Presentatio: 0.02 M Potassium Phosphate, pH 7.2, 0.15 M NaCl, 0.01% Sodium Azide, Storag: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Centrifuge product before removing cap. Only dilute immediately prior to use., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About APP / Beta Amyloid Precurso: Uniprot: P05067 NCBI: NM_000484 NP_000475.1
567.00 € 567.0 EUR
Goat anti‑Human APP / Beta Amyloid Precursor Polyclonal RW-C154910-100
Antibody: APP / Beta Amyloid Precursor Goat anti-Human Polyclonal (aa1-16) Antibody, Application: WB, Peptide-ELISA, Reactivity: Human, Monkey, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Beta Amyloid Precursor antibody RW-C154910 is an unconjugated goat polyclonal antibody to Beta Amyloid Precursor (APP) (aa1-16) from human. It is reactive with human, bovine, chicken and other species. Validated for Peptide-ELISA and WB., Targe: Human APP / Beta Amyloid Precursor, Synonym: APP | ABPP | A4 | ABETA | AD1 | Alzheimer disease | Amyloid beta | Beta-amyloid peptide | APPI | Beta amyloid | CVAP | AAA | PN2 | PreA4 | Amyloid beta A4 protein | Peptidase nexin-II | CTFgamma | PN-II | Protease nexin-II, Hos: Goat, Reactivit: Human, Monkey, Bovine, Dog, Guinea pig, Horse, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide., Modification: Unmodified, Immunoge: Peptide with sequence DAEFRHDSGYEVHHQK-C, from the N-Terminus of protein sequence according to NP_000475.1NP_958816.1NP_958817.1NP_001129601.1NP_001129602.1., Epitop: aa1-16, Specificit: Human APP. This antibody is expected to recognize all reported isoforms of APP (NP_000475.1; NP_958816.1; NP_958817.1; NP_001129601.1; NP_001129602.1) and to recognize all lengths of the Amyloid beta peptide., Application: Western blot (1 - 3 µg/ml)
Peptide Enzyme-Linked Immunosorbent Assay (1:8000), Usag: Peptide ELISA: antibody detection limit dilution 1:8000. Western blot: Approx 75kD band observed in Human Brain (Cerebral and Frontal cortex) lysates and in Mouse adult and fetal Brain lysates (calculated MW of 78.7kD according to NP_958817.1 and 72.6 according to NP_001129601.1). Recommended concentration: 1-3 ug/ml., Presentatio: TBS, pH 7.3, 0.02% Sodium Azide, 0.5% BSA, Storag: Aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About APP / Beta Amyloid Precurso: Uniprot: P05067 NCBI: NM_000484 NP_000475.1
503.00 € 503.0 EUR
Mouse anti‑Human APP / Beta Amyloid Precursor IgG2b Monoclonal RW-C179797-100
Antibody: APP / Beta Amyloid Precursor Mouse anti-Human Monoclonal (4E12) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Monkey, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Beta Amyloid Precursor antibody RW-C179797 is an unconjugated mouse monoclonal antibody to Beta Amyloid Precursor (APP) from human. It is reactive with human, bovine, chicken and other species. Validated for IHC and WB., Targe: Human APP / Beta Amyloid Precursor, Synonym: APP | ABPP | A4 | ABETA | AD1 | Alzheimer disease | Amyloid beta | Beta-amyloid peptide | APPI | Beta amyloid | CVAP | AAA | PN2 | PreA4 | Amyloid beta A4 protein | Peptidase nexin-II | CTFgamma | PN-II | Protease nexin-II, Hos: Mouse, Reactivit: Human, Monkey, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: IgG2b Monoclonal, Clon: 4E12, Conjugation: Unconjugated, Purificatio: Protein A purified, Modification: Unmodified, Immunoge: Synthetic human amyloid _ peptide (1-16 aa), DAEFRHDSGYEVHHQK, corresponding to amino acids 672-687 of human APP., Specificit: Human Beta Amyloid / APP, Application: IHC
IHC - Paraffin (10 µg/ml)
Western blot (1 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: Lyophilized from PBS, pH 7.2, 1% sucrose, Reconstitutio: 100 µl Distilled water, Storag: Store at 4°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About APP / Beta Amyloid Precurso: Uniprot: P05067 NCBI: NM_000484 NP_000475.1
423.00 € 423.0 EUR
Rabbit anti‑Human APP / Beta Amyloid Precursor IgG Polyclonal RW-C125072-100
Antibody: APP / Beta Amyloid Precursor Rabbit anti-Human Polyclonal (aa1-14) Antibody, Application: ELISA, Reactivity: Human, Monkey, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Format: Unconjugated, Unmodified, Descriptio: Beta Amyloid Precursor antibody RW-C125072 is an unconjugated rabbit polyclonal antibody to Beta Amyloid Precursor (APP) (aa1-14) from human. It is reactive with human, bovine, chicken and other species. Validated for ELISA., Targe: Human APP / Beta Amyloid Precursor, Synonym: APP | ABPP | A4 | ABETA | AD1 | Alzheimer disease | Amyloid beta | Beta-amyloid peptide | APPI | Beta amyloid | CVAP | AAA | PN2 | PreA4 | Amyloid beta A4 protein | Peptidase nexin-II | CTFgamma | PN-II | Protease nexin-II, Hos: Rabbit, Reactivit: Human, Monkey, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Antiserum, Modification: Unmodified, Immunoge: A synthetic peptide (DAEFRHDSGYEVHH) conjugated to BSA corresponding to aa 1-14 of mature human beta amyloid. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Sheep, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken (100%)., Epitop: aa1-14, Specificit: Recognizes beta Amyloid. Species cross-reactivity: rabbit. Species sequence homology: human., Application: ELISA, Usag: Suitable for use in ELISA., Presentatio: Lyophilized from PBS, pH 7.4, Reconstitutio: 100 µl Sterile 40-50% glycerol, distilled water., Storag: Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Reconstituted product is stable for 1 year at -20°C Aliquot and store at -20°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About APP / Beta Amyloid Precurso: Uniprot: P05067 NCBI: NM_000484 NP_000475.1
688.00 € 688.0 EUR
Rabbit anti‑Human ARNT / HIF-1-Beta Polyclonal RW-C434392-100
Antibody: ARNT / HIF-1-Beta Rabbit anti-Human Polyclonal (aa81-130) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: FITC, Unmodified, Other formats: Unconjugated HRP Biotin, Descriptio: HIF-1-Beta antibody RW-C434392 is an FITC-conjugated rabbit polyclonal antibody to HIF-1-Beta (ARNT) (aa81-130) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARNT / HIF-1-Beta, Synonym: ARNT | ARNT protein | BHLHe2 | HIF-1beta | HIF1-beta | HIF1BETA | TANGO | HIF-1-beta | HIF1B, Hos: Rabbit, Reactivit: Human, Chimpanzee, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with HRP, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa81-130 of human ARNT (A6NGV6). Percent identity by BLAST analysis: Human, Chimpanzee, Mouse, Rat, Sheep, Bovine, Rabbit, Horse, Pig, Guinea pig (100%); Gorilla, Gibbon, Monkey, Hamster, Elephant, Panda, Dog, Bat, Opossum, Turkey, Chicken, Platypus, Lizard, Xenopus, Trout, Medaka, Pufferfish, Nematode (92%); Tick (91%); Drosophila, Ant (85%); Beetle (84%)., Epitop: aa81-130, Specificit: Human ARNT / HIF-1-Beta, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARNT / HIF-1-Bet: Uniprot: P27540 NCBI: NM_001668 NP_001659.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARNT / HIF-1-Beta Polyclonal RW-C434391-100
Antibody: ARNT / HIF-1-Beta Rabbit anti-Human Polyclonal (aa81-130) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated HRP FITC, Descriptio: HIF-1-Beta antibody RW-C434391 is a biotin-conjugated rabbit polyclonal antibody to HIF-1-Beta (ARNT) (aa81-130) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARNT / HIF-1-Beta, Synonym: ARNT | ARNT protein | BHLHe2 | HIF-1beta | HIF1-beta | HIF1BETA | TANGO | HIF-1-beta | HIF1B, Hos: Rabbit, Reactivit: Human, Chimpanzee, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with HRP, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa81-130 of human ARNT (A6NGV6). Percent identity by BLAST analysis: Human, Chimpanzee, Mouse, Rat, Sheep, Bovine, Rabbit, Horse, Pig, Guinea pig (100%); Gorilla, Gibbon, Monkey, Hamster, Elephant, Panda, Dog, Bat, Opossum, Turkey, Chicken, Platypus, Lizard, Xenopus, Trout, Medaka, Pufferfish, Nematode (92%); Tick (91%); Drosophila, Ant (85%); Beetle (84%)., Epitop: aa81-130, Specificit: Human ARNT / HIF-1-Beta, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARNT / HIF-1-Bet: Uniprot: P27540 NCBI: NM_001668 NP_001659.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARNT / HIF-1-Beta Polyclonal RW-C433971-100
Antibody: ARNT / HIF-1-Beta Rabbit anti-Human Polyclonal (aa81-130) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: HIF-1-Beta antibody RW-C433971 is an HRP-conjugated rabbit polyclonal antibody to HIF-1-Beta (ARNT) (aa81-130) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARNT / HIF-1-Beta, Synonym: ARNT | ARNT protein | BHLHe2 | HIF-1beta | HIF1-beta | HIF1BETA | TANGO | HIF-1-beta | HIF1B, Hos: Rabbit, Reactivit: Human, Chimpanzee, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa81-130 of human ARNT (A6NGV6). Percent identity by BLAST analysis: Human, Chimpanzee, Mouse, Rat, Sheep, Bovine, Rabbit, Horse, Pig, Guinea pig (100%); Gorilla, Gibbon, Monkey, Hamster, Elephant, Panda, Dog, Bat, Opossum, Turkey, Chicken, Platypus, Lizard, Xenopus, Trout, Medaka, Pufferfish, Nematode (92%); Tick (91%); Drosophila, Ant (85%); Beetle (84%)., Epitop: aa81-130, Specificit: Human ARNT / HIF-1-Beta, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARNT / HIF-1-Bet: Uniprot: P27540 NCBI: NM_001668 NP_001659.1
469.00 € 469.0 EUR
Mouse anti‑Human ARNT / HIF-1-Beta IgG1,k Monoclonal RW-C140811-0.1
Antibody: ARNT / HIF-1-Beta Mouse anti-Human Monoclonal (aa496-789) (DY550) (H1beta234) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Ferret, Sheep, Format: DyLight 550, Unmodified, Other formats: Unconjugated Biotin DY650 DY488, Descriptio: HIF-1-Beta antibody RW-C140811 is a DY550-conjugated mouse monoclonal antibody to HIF-1-Beta (ARNT) (aa496-789) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ARNT / HIF-1-Beta, Synonym: ARNT | ARNT protein | BHLHe2 | HIF-1beta | HIF1-beta | HIF1BETA | TANGO | HIF-1-beta | HIF1B, Hos: Mouse, Reactivit: Human, Mouse, Rat, Bovine, Ferret, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG1,k Monoclonal, Clon: H1beta234, Conjugation: DyLight 550. Also available Unconjugated or conjugated with Biotin, DY650, DY488., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Fusion protein containing amino acids 496-789 of human HIF-1 beta, Epitop: aa496-789, Specificit: HIF 1 beta /ARNT., Application: IHC
IHC - Paraffin (1:100)
Western blot (1:500)
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 50 mM sodium borate, Storag: Store at 4°C. Do not freeze., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARNT / HIF-1-Bet: Uniprot: P27540 NCBI: NM_001668 NP_001659.1
416.00 € 416.0 EUR
Mouse anti‑Human ARNT / HIF-1-Beta IgG1,k Monoclonal RW-C140808-0.1
Antibody: ARNT / HIF-1-Beta Mouse anti-Human Monoclonal (aa496-789) (DY650) (H1beta234) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Ferret, Sheep, Format: DyLight 650, Unmodified, Other formats: Unconjugated Biotin DY488 DY550, Descriptio: HIF-1-Beta antibody RW-C140808 is a DY650-conjugated mouse monoclonal antibody to HIF-1-Beta (ARNT) (aa496-789) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ARNT / HIF-1-Beta, Synonym: ARNT | ARNT protein | BHLHe2 | HIF-1beta | HIF1-beta | HIF1BETA | TANGO | HIF-1-beta | HIF1B, Hos: Mouse, Reactivit: Human, Mouse, Rat, Bovine, Ferret, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG1,k Monoclonal, Clon: H1beta234, Conjugation: DyLight 650. Also available Unconjugated or conjugated with Biotin, DY488, DY550., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Fusion protein containing amino acids 496-789 of human HIF-1 beta, Epitop: aa496-789, Specificit: HIF 1 beta /ARNT., Application: IHC
IHC - Paraffin (1:100)
Western blot (1:500)
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 50 mM sodium borate, Storag: Store at 4°C. Do not freeze., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARNT / HIF-1-Bet: Uniprot: P27540 NCBI: NM_001668 NP_001659.1
416.00 € 416.0 EUR
Mouse anti‑Human ARNT / HIF-1-Beta IgG1,k Monoclonal RW-C140809-0.1
Antibody: ARNT / HIF-1-Beta Mouse anti-Human Monoclonal (aa496-789) (DY488) (H1beta234) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Ferret, Sheep, Format: DyLight 488, Unmodified, Other formats: Unconjugated Biotin DY650 DY550, Descriptio: HIF-1-Beta antibody RW-C140809 is a DY488-conjugated mouse monoclonal antibody to HIF-1-Beta (ARNT) (aa496-789) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ARNT / HIF-1-Beta, Synonym: ARNT | ARNT protein | BHLHe2 | HIF-1beta | HIF1-beta | HIF1BETA | TANGO | HIF-1-beta | HIF1B, Hos: Mouse, Reactivit: Human, Mouse, Rat, Bovine, Ferret, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG1,k Monoclonal, Clon: H1beta234, Conjugation: DyLight 488. Also available Unconjugated or conjugated with Biotin, DY650, DY550., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Fusion protein containing amino acids 496-789 of human HIF-1 beta, Epitop: aa496-789, Specificit: HIF 1 beta /ARNT., Application: IHC
IHC - Paraffin (1:100)
Western blot (1:500)
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 50 mM sodium borate, Storag: Store at 4°C. Do not freeze., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARNT / HIF-1-Bet: Uniprot: P27540 NCBI: NM_001668 NP_001659.1
416.00 € 416.0 EUR
Mouse anti‑Human ARNT / HIF-1-Beta IgG1,k Monoclonal RW-C140807-0.1
Antibody: ARNT / HIF-1-Beta Mouse anti-Human Monoclonal (aa496-789) (Biotin) (H1beta234) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Ferret, Sheep, Format: Biotin, Unmodified, Other formats: Unconjugated DY650 DY488 DY550, Descriptio: HIF-1-Beta antibody RW-C140807 is a biotin-conjugated mouse monoclonal antibody to HIF-1-Beta (ARNT) (aa496-789) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ARNT / HIF-1-Beta, Synonym: ARNT | ARNT protein | BHLHe2 | HIF-1beta | HIF1-beta | HIF1BETA | TANGO | HIF-1-beta | HIF1B, Hos: Mouse, Reactivit: Human, Mouse, Rat, Bovine, Ferret, Sheep (tested or 100% immunogen sequence identity), Clonalit: IgG1,k Monoclonal, Clon: H1beta234, Conjugation: Biotin. Also available Unconjugated or conjugated with DY650, DY488, DY550., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Fusion protein containing amino acids 496-789 of human HIF-1 beta, Epitop: aa496-789, Specificit: HIF 1 beta /ARNT., Application: IHC
IHC - Paraffin (1:100)
Western blot (1:500)
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Store at 4°C. Do not freeze., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARNT / HIF-1-Bet: Uniprot: P27540 NCBI: NM_001668 NP_001659.1
416.00 € 416.0 EUR
Rabbit anti‑Human ARNT / HIF-1-Beta Polyclonal RW-B492-50
Antibody: ARNT / HIF-1-Beta Rabbit anti-Human Polyclonal (aa496-789) Antibody, Application: IHC, IHC-P, WB, IP, Reactivity: Human, Mouse, Rat, Bovine, Ferret, Sheep, Format: Unconjugated, Unmodified, Descriptio: HIF-1-Beta antibody RW-B492 is an unconjugated rabbit polyclonal antibody to HIF-1-Beta (ARNT) (aa496-789) from human. It is reactive with human, mouse, rat and other species. Validated for IHC, IP and WB. Tested on 20 paraffin-embedded human tissues., Targe: Human ARNT / HIF-1-Beta, Synonym: ARNT | ARNT protein | BHLHe2 | HIF-1beta | HIF1-beta | HIF1BETA | TANGO | HIF-1-beta | HIF1B, Hos: Rabbit, Reactivit: Human, Mouse, Rat, Bovine, Ferret, Sheep (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Antiserum, Modification: Unmodified, Immunoge: Fusion protein to human HIF-1 beta. Containing a. a. 496-789, Epitop: aa496-789, Specificit: HIF-1 beta/ARNT. It is not known if NB100-110 Cross-reacts with ARNT2 which is related to HIF-1 beta/ARNT but is the product of a different gene., Application: IHC
IHC - Paraffin (1:200 - 1:300)
Western blot (1:2000)
Immunoprecipitation, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Immunohistochemistry: RW-B492 was validated for use in immunohistochemistry on a panel of 21 formalin-fixed, paraffin-embedded (FFPE) human tissues after heat induced antigen retrieval in pH 6.0 citrate buffer. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen. The stained slides were evaluated by a pathologist to confirm staining specificity. The optimal working concentration for RW-B492 was determined to be 1:200-1:300., Presentatio: Serum, 0.02% Sodium Azide, Storag: Short term: -20°C; Long term: -70°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARNT / HIF-1-Bet: Uniprot: P27540 NCBI: NM_001668 NP_001659.1
460.00 € 460.0 EUR
Mouse anti‑Human ARNT / HIF-1-Beta IgG1,k Monoclonal RW-C2562-0.1
Antibody: ARNT / HIF-1-Beta Mouse anti-Human Monoclonal (aa496-789) (H1beta234) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Mouse, Rat, Bovine, Ferret, Sheep, Primate, Format: Unconjugated, Unmodified, Other formats: Biotin DY650 DY488 DY550, Descriptio: HIF-1-Beta antibody RW-C2562 is an unconjugated mouse monoclonal antibody to HIF-1-Beta (ARNT) (aa496-789) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB., Targe: Human ARNT / HIF-1-Beta, Synonym: ARNT | ARNT protein | BHLHe2 | HIF-1beta | HIF1-beta | HIF1BETA | TANGO | HIF-1-beta | HIF1B, Hos: Mouse, Reactivit: Human, Mouse, Rat, Bovine, Ferret, Sheep, Primate (tested or 100% immunogen sequence identity), Clonalit: IgG1,k Monoclonal, Clon: H1beta234, Conjugation: Unconjugated. Also available conjugated with Biotin, DY650, DY488, DY550., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Fusion protein containing amino acids 496-789 of human HIF-1 beta, Epitop: aa496-789, Specificit: HIF 1 beta /ARNT., Application: IHC
IHC - Paraffin (1:1000)
Western blot (1:500), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, 0.05% Sodium Azide, Storag: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARNT / HIF-1-Bet: Uniprot: P27540 NCBI: NM_001668 NP_001659.1
386.00 € 386.0 EUR
Rabbit anti‑Human ARL8B Polyclonal RW-C462993-100
Antibody: ARL8B Rabbit anti-Human Polyclonal (aa107-156) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ARL8B antibody RW-C462993 is a biotin-conjugated rabbit polyclonal antibody to ARL8B (aa107-156) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARL8B, Synonym: ARL8B | Gie1 | ARL10C, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa107-156 of human ARL8B (Q9NVJ2, NP_060654). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Zebra finch, Chicken, Platypus, Lizard, Xenopus, Seabass, Catfish, Zebrafish (100%); Turkey, Salmon (92%)., Epitop: aa107-156, Specificit: Human ARL8B / ARL8A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARL8: Uniprot: Q9NVJ2 NCBI: NM_018184 NP_060654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARL8B Polyclonal RW-C462995-100
Antibody: ARL8B Rabbit anti-Human Polyclonal (aa107-156) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ARL8B antibody RW-C462995 is an HRP-conjugated rabbit polyclonal antibody to ARL8B (aa107-156) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARL8B, Synonym: ARL8B | Gie1 | ARL10C, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa107-156 of human ARL8B (Q9NVJ2, NP_060654). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Zebra finch, Chicken, Platypus, Lizard, Xenopus, Seabass, Catfish, Zebrafish (100%); Turkey, Salmon (92%)., Epitop: aa107-156, Specificit: Human ARL8B / ARL8A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARL8: Uniprot: Q9NVJ2 NCBI: NM_018184 NP_060654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARL8B Polyclonal RW-C462992-100
Antibody: ARL8B Rabbit anti-Human Polyclonal (aa71-120) (HRP) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ARL8B antibody RW-C462992 is an HRP-conjugated rabbit polyclonal antibody to ARL8B (aa71-120) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARL8B, Synonym: ARL8B | Gie1 | ARL10C, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa71-120 of human ARL8B (Q9NVJ2, NP_060654). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Chicken, Platypus, Lizard, Xenopus, Seabass (100%); Orangutan, Guinea pig, Zebra finch, Zebrafish (92%); Turkey, Catfish, Salmon, Beetle (85%)., Epitop: aa71-120, Specificit: Human ARL8B / ARL8A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARL8: Uniprot: Q9NVJ2 NCBI: NM_018184 NP_060654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARL8B Polyclonal RW-C462991-100
Antibody: ARL8B Rabbit anti-Human Polyclonal (aa71-120) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ARL8B antibody RW-C462991 is an FITC-conjugated rabbit polyclonal antibody to ARL8B (aa71-120) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARL8B, Synonym: ARL8B | Gie1 | ARL10C, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa71-120 of human ARL8B (Q9NVJ2, NP_060654). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Chicken, Platypus, Lizard, Xenopus, Seabass (100%); Orangutan, Guinea pig, Zebra finch, Zebrafish (92%); Turkey, Catfish, Salmon, Beetle (85%)., Epitop: aa71-120, Specificit: Human ARL8B / ARL8A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARL8: Uniprot: Q9NVJ2 NCBI: NM_018184 NP_060654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARL8B Polyclonal RW-C462994-100
Antibody: ARL8B Rabbit anti-Human Polyclonal (aa107-156) (FITC) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ARL8B antibody RW-C462994 is an FITC-conjugated rabbit polyclonal antibody to ARL8B (aa107-156) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARL8B, Synonym: ARL8B | Gie1 | ARL10C, Hos: Rabbit, Reactivit: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa107-156 of human ARL8B (Q9NVJ2, NP_060654). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Guinea pig, Zebra finch, Chicken, Platypus, Lizard, Xenopus, Seabass, Catfish, Zebrafish (100%); Turkey, Salmon (92%)., Epitop: aa107-156, Specificit: Human ARL8B / ARL8A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARL8: Uniprot: Q9NVJ2 NCBI: NM_018184 NP_060654.1
469.00 € 469.0 EUR
Rabbit anti‑Human ARL8B Polyclonal RW-C462990-100
Antibody: ARL8B Rabbit anti-Human Polyclonal (aa71-120) (Biotin) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ARL8B antibody RW-C462990 is a biotin-conjugated rabbit polyclonal antibody to ARL8B (aa71-120) from human. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Human ARL8B, Synonym: ARL8B | Gie1 | ARL10C, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa71-120 of human ARL8B (Q9NVJ2, NP_060654). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Elephant, Dog, Bovine, Bat, Rabbit, Horse, Pig, Opossum, Chicken, Platypus, Lizard, Xenopus, Seabass (100%); Orangutan, Guinea pig, Zebra finch, Zebrafish (92%); Turkey, Catfish, Salmon, Beetle (85%)., Epitop: aa71-120, Specificit: Human ARL8B / ARL8A, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ARL8: Uniprot: Q9NVJ2 NCBI: NM_018184 NP_060654.1
469.00 € 469.0 EUR