Follow us
Rabbit anti‑Mouse ABCC6 / MRP6 Polyclonal RW-C741104-100
Antibody: ABCC6 / MRP6 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: MRP6 antibody RW-C741104 is an APC-conjugated rabbit polyclonal antibody to mouse MRP6 (ABCC6). Validated for WB., Targe: Mouse ABCC6 / MRP6, Synonym: ABCC6 | ABC34 | EST349056 | MLP1 | MOAT-E | MRP6 | MOATE | URG7 | PXE1 | ARA | GACI2 | Pseudoxanthoma elasticum | PXE, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC6 / MRP: Uniprot: O95255 NCBI: NM_001171 NP_001162.4
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCC6 / MRP6 Polyclonal RW-C726669-100
Antibody: ABCC6 / MRP6 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: MRP6 antibody RW-C726669 is a PE-conjugated rabbit polyclonal antibody to mouse MRP6 (ABCC6). Validated for WB., Targe: Mouse ABCC6 / MRP6, Synonym: ABCC6 | ABC34 | EST349056 | MLP1 | MOAT-E | MRP6 | MOATE | URG7 | PXE1 | ARA | GACI2 | Pseudoxanthoma elasticum | PXE, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC6 / MRP: Uniprot: O95255 NCBI: NM_001171 NP_001162.4
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCC6 / MRP6 Polyclonal RW-C735595-100
Antibody: ABCC6 / MRP6 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: MRP6 antibody RW-C735595 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse MRP6 (ABCC6). Validated for WB., Targe: Mouse ABCC6 / MRP6, Synonym: ABCC6 | ABC34 | EST349056 | MLP1 | MOAT-E | MRP6 | MOATE | URG7 | PXE1 | ARA | GACI2 | Pseudoxanthoma elasticum | PXE, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC6 / MRP: Uniprot: O95255 NCBI: NM_001171 NP_001162.4
3,781.00 € 3781.0 EUR
Rat anti‑Mouse ABCC6 / MRP6 IgG2a Monoclonal RW-C756819-1
Antibody: ABCC6 / MRP6 Rat anti-Mouse Monoclonal (aa 843-999.) (Concentrated) (M6II-24) Antibody, Application: IHC-Fr, WB, ELISA, Reactivity: Mouse, Format: Unconjugated, Concentrated, Descriptio: MRP6 antibody RW-C756819 is an unconjugated rat monoclonal antibody to mouse MRP6 (ABCC6) (aa 843-999.). Validated for ELISA, IHC and WB., Targe: Mouse ABCC6 / MRP6, Synonym: ABCC6 | ABC34 | EST349056 | MLP1 | MOAT-E | MRP6 | MOATE | URG7 | PXE1 | ARA | GACI2 | Pseudoxanthoma elasticum | PXE, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a Monoclonal, Clon: M6II-24, Conjugation: Unconjugated, Modification: Concentrated, Immunoge: Bacterial fusion protein of mouse Mrp6, containing amino acids 843-999, Epitop: aa 843-999., Application: IHC - Frozen
Western blot
ELISA, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: Tissue Culture Supernatant, 0.7% BSA, 0.1% Sodium Azide, Storag: Store at 2-8°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC6 / MRP: Uniprot: O95255 NCBI: NM_001171 NP_001162.4
522.00 € 522.0 EUR
Rat anti‑Mouse ABCC6 / MRP6 IgG2b Monoclonal RW-C756818-1
Antibody: ABCC6 / MRP6 Rat anti-Mouse Monoclonal (aa 843-999.) (Concentrated) (M6II-68) Antibody, Application: IHC-Fr, ICC, WB, Reactivity: Mouse, Format: Unconjugated, Concentrated, Descriptio: MRP6 antibody RW-C756818 is an unconjugated rat monoclonal antibody to mouse MRP6 (ABCC6) (aa 843-999.). Validated for ICC, IHC and WB., Targe: Mouse ABCC6 / MRP6, Synonym: ABCC6 | ABC34 | EST349056 | MLP1 | MOAT-E | MRP6 | MOATE | URG7 | PXE1 | ARA | GACI2 | Pseudoxanthoma elasticum | PXE, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2b Monoclonal, Clon: M6II-68, Conjugation: Unconjugated, Modification: Concentrated, Immunoge: Bacterial fusion protein of mouse Mrp6, containing amino acids 843-999, Epitop: aa 843-999., Application: IHC - Frozen
ICC
Western blot, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: IHC: 1:20-1:50, Presentatio: Tissue Culture Supernatant, 0.7% BSA, 0.1% Sodium Azide, Storag: Store at 2-8°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC6 / MRP: Uniprot: O95255 NCBI: NM_001171 NP_001162.4
522.00 € 522.0 EUR
Rat anti‑Mouse ABCC5 / MRP5 IgG2a Monoclonal RW-C124153-1
Antibody: ABCC5 / MRP5 Rat anti-Mouse Monoclonal (aa1-38) (M5I-10) Antibody, Application: IHC, IHC-Fr, ICC, WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: MRP5 antibody RW-C124153 is an unconjugated rat monoclonal antibody to mouse MRP5 (ABCC5) (aa1-38). Validated for ICC, IHC and WB., Targe: Mouse ABCC5 / MRP5, Synonym: ABCC5 | ABC33 | Abcc5a | MOATC | MRP5 | PABC11 | SMRP | EST277145 | MOAT-C, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a Monoclonal, Clon: M5I-10, Conjugation: Unconjugated, Purificatio: Tissue culture supernatant, Modification: Unmodified, Immunoge: Bacterial fusion protein of mouse Mrp5, aa 1-38., Epitop: aa1-38, Specificit: Recognizes an internal epitope of MRP5 (ABCC5), at ~160kD., Application: IHC
IHC - Frozen (1:20 - 1:50)
ICC (1:20 - 1:50)
Western blot (1:20 - 1:50), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Suitable for use in Western Blot, Immunohistochemistry and Immunocytochemistry. Western Blot: 1:20-1:50. Immunohistochemistry (acetone fixed frozen): 1:20-1:50. Immunocytochemistry (acetone fixed): 1:20-1:50., Presentatio: 0.1% Sodium Azide, 0.7% BSA, Storag: May be stored at 4°C for short-term only. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Aliquots are stable for up to 1 year., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC5 / MRP: Uniprot: O15440 NCBI: NM_005688 NP_005679.2
836.00 € 836.0 EUR
Goat anti‑Mouse ABCC4 / MRP4 Polyclonal RW-C186435-100
Antibody: ABCC4 / MRP4 Goat anti-Mouse Polyclonal (aa70-82) Antibody, Application: Peptide-ELISA, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: MRP4 antibody RW-C186435 is an unconjugated goat polyclonal antibody to mouse MRP4 (ABCC4) (aa70-82). Validated for Peptide-ELISA., Targe: Mouse ABCC4 / MRP4, Synonym: ABCC4 | EST170205 | MOAT-B | Multidrug resistance protein 4 | MOATB | MRP4, Hos: Goat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide., Modification: Unmodified, Immunoge: Peptide with sequence RAKKDSRKPSLTK-C, from the N-Terminus (near) of the protein sequence according to NP_001028508.2NP_001157147.1NP_001157148.1., Epitop: aa70-82, Specificit: Mouse ABCC4 / MRP4. This antibody is expected to recognize all reported isoforms (NP_001028508.2; NP_001157147.1; NP_001157148.1)., Application: Peptide Enzyme-Linked Immunosorbent Assay (1:128000), Usag: Peptide ELISA: antibody detection limit dilution 1:128000. Western blot: Preliminary experiments in Mouse and Rat Heart lysates gave no specific signal but low background (at antibody concentration up to 1 ug/ml)., Presentatio: TBS, pH 7.3, 0.02% Sodium Azide, 0.5% BSA, Storag: Aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC4 / MRP: Uniprot: O15439 NCBI: NM_005845 NP_005836.2
401.00 € 401.0 EUR
Rabbit-New Zealand White anti‑Mouse ABCC3 / MRP3 Polyclonal RW-C829592-100
Antibody: ABCC3 / MRP3 Rabbit-New Zealand White anti-Mouse Polyclonal (aa850-900) Antibody, Application: IHC, WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: MRP3 antibody RW-C829592 is an unconjugated rabbit-new zealand white polyclonal antibody to mouse MRP3 (ABCC3) (aa850-900). Validated for IHC and WB., Targe: Mouse ABCC3 / MRP3, Synonym: ABCC3 | ABC31 | EST90757 | MOAT-D | MLP2 | Multidrug resistance protein 3 | MRP3 | CMOAT2, Hos: Rabbit-New Zealand White, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Immunoge: A synthetic peptide from aa region 850-900 of mouse ABCC3 conjugated to blue carrier protein was used as the antigen., Epitop: aa850-900, Application: IHC (1:300 - 1:2000)
Western blot (1:300 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: Lyophilized. Whole Serum., Reconstitutio: Reconstitute in 100 ul of sterile water. Centrifuge to remove any insoluble material. Glycerol (1:1) may be added for an additional stability., Storag: Store at 2°C to 8°C for short term storage, or at -20°C for long term storage. Stable for up to 12 months after reconstitution. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC3 / MRP: Uniprot: O15438 NCBI: NM_003786 AAD02845.1
393.00 € 393.0 EUR
Rabbit anti‑Mouse ABCC2 / MRP2 Polyclonal RW-C445409-100
Antibody: ABCC2 / MRP2 Rabbit anti-Mouse Polyclonal (aa651-700) (HRP) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Monkey, Bovine, Dog, Rabbit, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated FITC Biotin, Descriptio: MRP2 antibody RW-C445409 is an HRP-conjugated rabbit polyclonal antibody to MRP2 (ABCC2) (aa651-700) from mouse. It is reactive with human, mouse, bovine and other species. Validated for WB., Targe: Mouse ABCC2 / MRP2, Synonym: ABCC2 | ABC30 | CMOAT1 | CMOAT | DJS | Multidrug resistance protein 2 | MRP2 | CMRP, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Monkey, Bovine, Dog, Rabbit (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with FITC, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa651-700 of mouse Abcc2 (Q8VI47, NP_038834). Percent identity by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rabbit (100%); Elephant, Bat, Horse, Guinea pig (92%); Galago, Rat, Panda, Dog (85%)., Epitop: aa651-700, Specificit: Mouse ABCC2 / MRP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC2 / MRP: Uniprot: Q92887 NCBI: NM_000392 NP_000383.1
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCC2 / MRP2 Polyclonal RW-C445407-100
Antibody: ABCC2 / MRP2 Rabbit anti-Mouse Polyclonal (aa651-700) (FITC) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Monkey, Bovine, Dog, Rabbit, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: MRP2 antibody RW-C445407 is an FITC-conjugated rabbit polyclonal antibody to MRP2 (ABCC2) (aa651-700) from mouse. It is reactive with human, mouse, bovine and other species. Validated for WB., Targe: Mouse ABCC2 / MRP2, Synonym: ABCC2 | ABC30 | CMOAT1 | CMOAT | DJS | Multidrug resistance protein 2 | MRP2 | CMRP, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Monkey, Bovine, Dog, Rabbit (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa651-700 of mouse Abcc2 (Q8VI47, NP_038834). Percent identity by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rabbit (100%); Elephant, Bat, Horse, Guinea pig (92%); Galago, Rat, Panda, Dog (85%)., Epitop: aa651-700, Specificit: Mouse ABCC2 / MRP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC2 / MRP: Uniprot: Q92887 NCBI: NM_000392 NP_000383.1
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCC2 / MRP2 Polyclonal RW-C445408-100
Antibody: ABCC2 / MRP2 Rabbit anti-Mouse Polyclonal (aa651-700) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Monkey, Bovine, Dog, Rabbit, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: MRP2 antibody RW-C445408 is a biotin-conjugated rabbit polyclonal antibody to MRP2 (ABCC2) (aa651-700) from mouse. It is reactive with human, mouse, bovine and other species. Validated for WB., Targe: Mouse ABCC2 / MRP2, Synonym: ABCC2 | ABC30 | CMOAT1 | CMOAT | DJS | Multidrug resistance protein 2 | MRP2 | CMRP, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Monkey, Bovine, Dog, Rabbit (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa651-700 of mouse Abcc2 (Q8VI47, NP_038834). Percent identity by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rabbit (100%); Elephant, Bat, Horse, Guinea pig (92%); Galago, Rat, Panda, Dog (85%)., Epitop: aa651-700, Specificit: Mouse ABCC2 / MRP2, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC2 / MRP: Uniprot: Q92887 NCBI: NM_000392 NP_000383.1
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCC2 / MRP2 Polyclonal RW-C46803-0.1
Antibody: ABCC2 / MRP2 Rabbit anti-Mouse Polyclonal (C-Terminus) Antibody, Application: WB, ELISA, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: MRP2 antibody RW-C46803 is an unconjugated rabbit polyclonal antibody to mouse MRP2 (ABCC2) (C-Terminus). Validated for ELISA and WB., Targe: Mouse ABCC2 / MRP2, Synonym: ABCC2 | ABC30 | CMOAT1 | CMOAT | DJS | Multidrug resistance protein 2 | MRP2 | CMRP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide from mouse ABCC2 / MRP2., Epitop: C-Terminus, Specificit: synthetic peptide corresponding to C-terminal residues of mouse Abcc2(ATP-binding cassette, sub-family C, member 2), Application: Western blot (1 µg/ml)
ELISA (1 µg/ml), Failed Application: IHC - Paraffin, Presentatio: PBS, 0.01% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Aliquot to avoid freeze-thaw cycles. Store undiluted., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC2 / MRP: Uniprot: Q92887 NCBI: NM_000392 NP_000383.1
379.00 € 379.0 EUR
Rabbit anti‑Mouse ABCC2 / MRP2 Polyclonal RW-C135135-100
Antibody: ABCC2 / MRP2 Rabbit anti-Mouse Polyclonal (aa651-700) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: FITC Biotin HRP, Descriptio: MRP2 antibody RW-C135135 is an unconjugated rabbit polyclonal antibody to mouse MRP2 (ABCC2) (aa651-700). Validated for WB., Targe: Mouse ABCC2 / MRP2, Synonym: ABCC2 | ABC30 | CMOAT1 | CMOAT | DJS | Multidrug resistance protein 2 | MRP2 | CMRP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with FITC, Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa651-700 of mouse Abcc2 (Q8VI47, NP_038834). Percent identity by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rabbit (100%); Elephant, Bat, Horse, Guinea pig (92%); Galago, Rat, Panda, Dog (85%)., Epitop: aa651-700, Specificit: Mouse ABCC2 / MRP2, Application: Western blot (0.2 - 1 µg/ml), Usag: Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as secondary antibody., Presentatio: PBS, 0.09% sodium azide, 2% sucrose, Storag: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC2 / MRP: Uniprot: Q92887 NCBI: NM_000392 NP_000383.1
424.00 € 424.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C694885-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: MRP9 antibody RW-C694885 is an FITC-conjugated rabbit polyclonal antibody to mouse MRP9 (ABCC12). Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC11, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C712614-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: MRP9 antibody RW-C712614 is an HRP-conjugated rabbit polyclonal antibody to mouse MRP9 (ABCC12). Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC11, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C703589-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: MRP9 antibody RW-C703589 is a Cy3-conjugated rabbit polyclonal antibody to mouse MRP9 (ABCC12). Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC11, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C687973-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: MRP9 antibody RW-C687973 is a biotin-conjugated rabbit polyclonal antibody to mouse MRP9 (ABCC12). Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC11, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C663365-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: MRP9 antibody RW-C663365 is an unconjugated rabbit polyclonal antibody to mouse MRP9 (ABCC12). Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC11, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC11., Application: Western blot, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C445511-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (aa561-610) (HRP) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Rat, Bovine, Dog, Horse, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: MRP9 antibody RW-C445511 is an HRP-conjugated rabbit polyclonal antibody to MRP9 (ABCC12) (aa561-610) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Rat, Bovine, Dog, Horse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa561-610 of mouse Abcc12 (Q80WJ6, NP_766500). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Elephant, Dog, Bovine, Horse (100%); Bat, Rabbit, Guinea pig (92%); Galago (85%); Beetle (83%); Drosophila (81%)., Epitop: aa561-610, Specificit: Mouse ABCC12, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C445508-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (aa561-610) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Rat, Bovine, Dog, Horse, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: MRP9 antibody RW-C445508 is a biotin-conjugated rabbit polyclonal antibody to MRP9 (ABCC12) (aa561-610) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Rat, Bovine, Dog, Horse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa561-610 of mouse Abcc12 (Q80WJ6, NP_766500). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Elephant, Dog, Bovine, Horse (100%); Bat, Rabbit, Guinea pig (92%); Galago (85%); Beetle (83%); Drosophila (81%)., Epitop: aa561-610, Specificit: Mouse ABCC12, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C445510-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (aa561-610) (FITC) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Rat, Bovine, Dog, Horse, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: MRP9 antibody RW-C445510 is an FITC-conjugated rabbit polyclonal antibody to MRP9 (ABCC12) (aa561-610) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Rat, Bovine, Dog, Horse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa561-610 of mouse Abcc12 (Q80WJ6, NP_766500). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Elephant, Dog, Bovine, Horse (100%); Bat, Rabbit, Guinea pig (92%); Galago (85%); Beetle (83%); Drosophila (81%)., Epitop: aa561-610, Specificit: Mouse ABCC12, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C135141-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (aa561-610) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Biotin FITC HRP, Descriptio: MRP9 antibody RW-C135141 is an unconjugated rabbit polyclonal antibody to mouse MRP9 (ABCC12) (aa561-610). Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa561-610 of mouse Abcc12 (Q80WJ6, NP_766500). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Elephant, Dog, Bovine, Horse (100%); Bat, Rabbit, Guinea pig (92%); Galago (85%); Beetle (83%); Drosophila (81%)., Epitop: aa561-610, Specificit: Mouse ABCC12, Application: Western blot (0.2 - 1 µg/ml), Usag: Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as secondary antibody., Presentatio: PBS, 0.09% sodium azide, 2% sucrose, Storag: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
424.00 € 424.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C741105-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: MRP9 antibody RW-C741105 is an APC-conjugated rabbit polyclonal antibody to mouse MRP9 (ABCC12). Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC11, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C726673-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: MRP9 antibody RW-C726673 is a PE-conjugated rabbit polyclonal antibody to mouse MRP9 (ABCC12). Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC11, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCC12 / MRP9 Polyclonal RW-C735599-100
Antibody: ABCC12 / MRP9 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: MRP9 antibody RW-C735599 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse MRP9 (ABCC12). Validated for WB., Targe: Mouse ABCC12 / MRP9, Synonym: ABCC12 | MRP9, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCC11, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCC11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC12 / MRP: Uniprot: Q96J65 NCBI: NM_033226 NP_150229.2
3,781.00 € 3781.0 EUR
Rabbit anti‑Mouse ABCB9 Polyclonal RW-C694894-100
Antibody: ABCB9 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCB9 antibody RW-C694894 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCB9. Validated for WB., Targe: Mouse ABCB9, Synonym: ABCB9 | ABC transporter 9 protein | EST122234 | HABCB9 | TAP-like ABC transporter | TAPL | KIAA1520 | TAP-like protein, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NP78 NCBI: NM_019625 NP_062571.1
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCB9 Polyclonal RW-C718378-100
Antibody: ABCB9 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCB9 antibody RW-C718378 is an APC-conjugated rabbit polyclonal antibody to mouse ABCB9. Validated for WB., Targe: Mouse ABCB9, Synonym: ABCB9 | ABC transporter 9 protein | EST122234 | HABCB9 | TAP-like ABC transporter | TAPL | KIAA1520 | TAP-like protein, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NP78 NCBI: NM_019625 NP_062571.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB9 Polyclonal RW-C712626-100
Antibody: ABCB9 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCB9 antibody RW-C712626 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCB9. Validated for WB., Targe: Mouse ABCB9, Synonym: ABCB9 | ABC transporter 9 protein | EST122234 | HABCB9 | TAP-like ABC transporter | TAPL | KIAA1520 | TAP-like protein, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NP78 NCBI: NM_019625 NP_062571.1
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCB9 Polyclonal RW-C703599-100
Antibody: ABCB9 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCB9 antibody RW-C703599 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCB9. Validated for WB., Targe: Mouse ABCB9, Synonym: ABCB9 | ABC transporter 9 protein | EST122234 | HABCB9 | TAP-like ABC transporter | TAPL | KIAA1520 | TAP-like protein, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NP78 NCBI: NM_019625 NP_062571.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB9 Polyclonal RW-C687984-100
Antibody: ABCB9 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCB9 antibody RW-C687984 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCB9. Validated for WB., Targe: Mouse ABCB9, Synonym: ABCB9 | ABC transporter 9 protein | EST122234 | HABCB9 | TAP-like ABC transporter | TAPL | KIAA1520 | TAP-like protein, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NP78 NCBI: NM_019625 NP_062571.1
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCB9 Polyclonal RW-C663366-100
Antibody: ABCB9 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCB9 antibody RW-C663366 is an unconjugated rabbit polyclonal antibody to mouse ABCB9. Validated for WB., Targe: Mouse ABCB9, Synonym: ABCB9 | ABC transporter 9 protein | EST122234 | HABCB9 | TAP-like ABC transporter | TAPL | KIAA1520 | TAP-like protein, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB9., Application: Western blot, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NP78 NCBI: NM_019625 NP_062571.1
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCB9 Polyclonal RW-C726681-100
Antibody: ABCB9 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCB9 antibody RW-C726681 is a PE-conjugated rabbit polyclonal antibody to mouse ABCB9. Validated for WB., Targe: Mouse ABCB9, Synonym: ABCB9 | ABC transporter 9 protein | EST122234 | HABCB9 | TAP-like ABC transporter | TAPL | KIAA1520 | TAP-like protein, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NP78 NCBI: NM_019625 NP_062571.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB9 Polyclonal RW-C735611-100
Antibody: ABCB9 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCB9 antibody RW-C735611 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCB9. Validated for WB., Targe: Mouse ABCB9, Synonym: ABCB9 | ABC transporter 9 protein | EST122234 | HABCB9 | TAP-like ABC transporter | TAPL | KIAA1520 | TAP-like protein, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NP78 NCBI: NM_019625 NP_062571.1
3,781.00 € 3781.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C694892-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCB8 antibody RW-C694892 is an FITC-conjugated rabbit polyclonal antibody to ABCB8 from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C718377-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCB8 antibody RW-C718377 is an APC-conjugated rabbit polyclonal antibody to ABCB8 from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C712622-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCB8 antibody RW-C712622 is an HRP-conjugated rabbit polyclonal antibody to ABCB8 from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C703598-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCB8 antibody RW-C703598 is a Cy3-conjugated rabbit polyclonal antibody to ABCB8 from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C687982-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCB8 antibody RW-C687982 is a biotin-conjugated rabbit polyclonal antibody to ABCB8 from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C663948-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCB8 antibody RW-C663948 is an unconjugated rabbit polyclonal antibody to ABCB8 from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB8., Application: Western blot, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C445464-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (aa316-365) (FITC) Antibody, Application: WB, Reactivity: Mouse, Human, Chimpanzee, Orangutan, Gibbon, Monkey, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Rabbit, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ABCB8 antibody RW-C445464 is an FITC-conjugated rabbit polyclonal antibody to ABCB8 (aa316-365) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Human, Chimpanzee, Orangutan, Gibbon, Monkey, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Rabbit (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa316-365 of mouse Abcb8 (Q9CXJ4, NP_083296). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Guinea pig (100%); Pig (92%); Opossum (91%); Stickleback (84%)., Epitop: aa316-365, Specificit: Mouse ABCB8, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C445466-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (aa316-365) (HRP) Antibody, Application: WB, Reactivity: Mouse, Human, Chimpanzee, Orangutan, Gibbon, Monkey, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Rabbit, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated FITC Biotin, Descriptio: ABCB8 antibody RW-C445466 is an HRP-conjugated rabbit polyclonal antibody to ABCB8 (aa316-365) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Human, Chimpanzee, Orangutan, Gibbon, Monkey, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Rabbit (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with FITC, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa316-365 of mouse Abcb8 (Q9CXJ4, NP_083296). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Guinea pig (100%); Pig (92%); Opossum (91%); Stickleback (84%)., Epitop: aa316-365, Specificit: Mouse ABCB8, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C445465-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (aa316-365) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Human, Chimpanzee, Orangutan, Gibbon, Monkey, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Rabbit, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ABCB8 antibody RW-C445465 is a biotin-conjugated rabbit polyclonal antibody to ABCB8 (aa316-365) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Human, Chimpanzee, Orangutan, Gibbon, Monkey, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Rabbit (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa316-365 of mouse Abcb8 (Q9CXJ4, NP_083296). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Guinea pig (100%); Pig (92%); Opossum (91%); Stickleback (84%)., Epitop: aa316-365, Specificit: Mouse ABCB8, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C151235-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (aa316-365) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: FITC Biotin HRP, Descriptio: ABCB8 antibody RW-C151235 is an unconjugated rabbit polyclonal antibody to mouse ABCB8 (aa316-365). Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with FITC, Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa316-365 of mouse Abcb8 (Q9CXJ4, NP_083296). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Horse, Guinea pig (100%); Pig (92%); Opossum (91%); Stickleback (84%)., Epitop: aa316-365, Specificit: Mouse ABCB8, Application: Western blot, Presentatio: PBS, 0.09% sodium azide, 2% sucrose, Storag: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
424.00 € 424.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C726680-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCB8 antibody RW-C726680 is a PE-conjugated rabbit polyclonal antibody to ABCB8 from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB8 Polyclonal RW-C735606-100
Antibody: ABCB8 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCB8 antibody RW-C735606 is an APC, Cy7-conjugated rabbit polyclonal antibody to ABCB8 from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
3,781.00 € 3781.0 EUR
Rabbit-New Zealand White anti‑Mouse ABCB8 Polyclonal RW-C829270-100
Antibody: ABCB8 Rabbit-New Zealand White anti-Mouse Polyclonal Antibody, Application: IHC, WB, Reactivity: Mouse, Human, Format: Unconjugated, Unmodified, Descriptio: ABCB8 antibody RW-C829270 is an unconjugated rabbit-new zealand white polyclonal antibody to ABCB8 from mouse. It is reactive with human and mouse. Validated for IHC and WB., Targe: Mouse ABCB8, Synonym: ABCB8 | MABC1 | M-ABC1 | Mitochondrial ABC protein | EST328128, Hos: Rabbit-New Zealand White, Reactivit: Mouse, Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Immunoge: A synthetic peptide from aa region 600-700 of mouse ABCB8 conjugated to an immunogenic carrier protein was used as the antigen., Application: IHC (1:300 - 1:2000)
Western blot (1:300 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: Lyophilized. Whole Serum., Reconstitutio: Reconstitute in 100 ul of sterile water. Centrifuge to remove any insoluble material. Glycerol (1:1) may be added for an additional stability., Storag: Store at 2°C to 8°C for short term storage, or at -20°C for long term storage. Stable for up to 12 months after reconstitution. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NUT2 NCBI: NM_007188 NP_009119.2
393.00 € 393.0 EUR
Rabbit anti‑Mouse ABCB7 Polyclonal RW-C694893-100
Antibody: ABCB7 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCB7 antibody RW-C694893 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCB7. Validated for WB., Targe: Mouse ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB7, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB7., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCB7 Polyclonal RW-C712619-100
Antibody: ABCB7 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCB7 antibody RW-C712619 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCB7. Validated for WB., Targe: Mouse ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB7, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB7., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCB7 Polyclonal RW-C703594-100
Antibody: ABCB7 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCB7 antibody RW-C703594 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCB7. Validated for WB., Targe: Mouse ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB7, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB7., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB7 Polyclonal RW-C687978-100
Antibody: ABCB7 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCB7 antibody RW-C687978 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCB7. Validated for WB., Targe: Mouse ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB7, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB7., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCB7 Polyclonal RW-C663364-100
Antibody: ABCB7 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCB7 antibody RW-C663364 is an unconjugated rabbit polyclonal antibody to mouse ABCB7. Validated for WB., Targe: Mouse ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB7, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB7., Application: Western blot, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCB7 Polyclonal RW-C741107-100
Antibody: ABCB7 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCB7 antibody RW-C741107 is an APC-conjugated rabbit polyclonal antibody to mouse ABCB7. Validated for WB., Targe: Mouse ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB7, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB7., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB7 Polyclonal RW-C726677-100
Antibody: ABCB7 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCB7 antibody RW-C726677 is a PE-conjugated rabbit polyclonal antibody to mouse ABCB7. Validated for WB., Targe: Mouse ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB7, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB7., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB7 Polyclonal RW-C735603-100
Antibody: ABCB7 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCB7 antibody RW-C735603 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCB7. Validated for WB., Targe: Mouse ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB7, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB7., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1
3,781.00 € 3781.0 EUR
Rabbit-New Zealand White anti‑Mouse ABCB7 Polyclonal RW-C829636-100
Antibody: ABCB7 Rabbit-New Zealand White anti-Mouse Polyclonal Antibody, Application: IHC, WB, Reactivity: Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ABCB7 antibody RW-C829636 is an unconjugated rabbit-new zealand white polyclonal antibody to ABCB7 from mouse. It is reactive with mouse and rat. Validated for IHC and WB., Targe: Mouse ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit-New Zealand White, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Predicte: Human (at least 90% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Immunoge: A synthetic peptide from aa region 300-400 of mouse ABCB7 conjugated to an immunogenic carrier protein was used as the antigen., Application: IHC (1:300 - 1:2000)
Western blot (1:300 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: Lyophilized. Whole Serum., Reconstitutio: Reconstitute in 100 ul of sterile water. Centrifuge to remove any insoluble material. Glycerol (1:1) may be added for an additional stability., Storag: Store at 2°C to 8°C for short term storage, or at -20°C for long term storage. Stable for up to 12 months after reconstitution. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1
393.00 € 393.0 EUR
Rabbit-New Zealand White anti‑Mouse ABCB6 Polyclonal RW-C829404-100
Antibody: ABCB6 Rabbit-New Zealand White anti-Mouse Polyclonal Antibody, Application: IHC, WB, Reactivity: Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ABCB6 antibody RW-C829404 is an unconjugated rabbit-new zealand white polyclonal antibody to ABCB6 from mouse. It is reactive with mouse and rat. Validated for IHC and WB., Targe: Mouse ABCB6, Synonym: ABCB6 | ABC14 | ABC | EST45597 | LAN | MTABC3 | PrP | P-glycoprotein-related protein | MCOPCB7 | Mt-ABC transporter 3 | Umat, Hos: Rabbit-New Zealand White, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Predicte: Human (at least 90% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Immunoge: A synthetic peptide from aa region 400-500 of mouse ABCB6 conjugated to an immunogenic carrier protein was used as the antigen., Application: IHC (1:300 - 1:2000)
Western blot (1:300 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: Lyophilized. Whole Serum., Reconstitutio: Reconstitute in 100 ul of sterile water. Centrifuge to remove any insoluble material. Glycerol (1:1) may be added for an additional stability., Storag: Store at 2°C to 8°C for short term storage, or at -20°C for long term storage. Stable for up to 12 months after reconstitution. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: Q9NP58 NCBI: AJ289233 AAH00559.1
393.00 € 393.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 Polyclonal RW-C694886-100
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: MDR3 antibody RW-C694886 is an FITC-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for WB. Cited in 1 publication., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB4, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB4., Application: Western blot
Applications tested for the base form of this product only, Presentatio: 0.01 M PBS, pH 7.4, 0.05% ProClin™ 300, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 Polyclonal RW-C712615-100
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: MDR3 antibody RW-C712615 is an HRP-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB4, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB4., Application: Western blot
Applications tested for the base form of this product only, Presentatio: 0.01 M PBS, pH 7.4, 0.05% ProClin™ 300, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 Polyclonal RW-C703590-100
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: MDR3 antibody RW-C703590 is a Cy3-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB4, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB4., Application: Western blot
Applications tested for the base form of this product only, Presentatio: 0.01 M PBS, pH 7.4, 0.05% ProClin™ 300, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 Polyclonal RW-C687977-100
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: MDR3 antibody RW-C687977 is a biotin-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB4, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB4., Application: Western blot
Applications tested for the base form of this product only, Presentatio: 0.01 M PBS, pH 7.4, 0.05% ProClin™ 300, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 Polyclonal RW-C663363-100
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: MDR3 antibody RW-C663363 is an unconjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB4, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB4., Application: Western blot, Presentatio: 0.01 M PBS, pH 7.4, 0.05% ProClin™ 300, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 IgG Polyclonal RW-C369044-50
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, ELISA, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: MDR3 antibody RW-C369044 is an HRP-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for ELISA and WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Caprylic acid and ammonium sulfate precipitation, Modification: Unmodified, Immunoge: Recombinant mouse Multidrug resistance protein 3 protein., Specificit: Mouse ABCB4 / MDR3, Application: Western blot
ELISA
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, pH 7.4, 0.03% Proclin 300, 50% glycerol., Storag: Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
360.00 € 360.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 IgG Polyclonal RW-C317105-50
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, ELISA, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: MDR3 antibody RW-C317105 is a biotin-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for ELISA and WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Caprylic acid and ammonium sulfate precipitation, Modification: Unmodified, Immunoge: Recombinant mouse Multidrug resistance protein 3 protein., Specificit: Mouse ABCB4 / MDR3, Application: Western blot
ELISA
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, pH 7.4, 0.03% Proclin 300, 50% glycerol., Storag: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
360.00 € 360.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 IgG Polyclonal RW-C318753-50
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, ELISA, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: MDR3 antibody RW-C318753 is an FITC-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for ELISA and WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Caprylic acid and ammonium sulfate precipitation, Modification: Unmodified, Immunoge: Recombinant mouse Multidrug resistance protein 3 protein., Specificit: Mouse ABCB4 / MDR3, Application: Western blot
ELISA
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, pH 7.4, 0.03% Proclin 300, 50% glycerol., Storag: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
360.00 € 360.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 IgG Polyclonal RW-C285442-50
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal Antibody, Application: ELISA, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Biotin FITC HRP, Descriptio: MDR3 antibody RW-C285442 is an unconjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for ELISA., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, HRP., Purificatio: Caprylic acid and ammonium sulfate precipitation, Modification: Unmodified, Immunoge: Recombinant mouse Multidrug resistance protein 3 protein., Specificit: Mouse ABCB4 / MDR3, Application: ELISA, Presentatio: PBS, pH 7.4, 0.03% Proclin 300, 50% glycerol., Storag: Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
360.00 € 360.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 Polyclonal RW-C741108-100
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: MDR3 antibody RW-C741108 is an APC-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB4, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB4., Application: Western blot
Applications tested for the base form of this product only, Presentatio: 0.01 M PBS, pH 7.4, 0.05% ProClin™ 300, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 Polyclonal RW-C726675-100
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: MDR3 antibody RW-C726675 is a PE-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB4, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB4., Application: Western blot
Applications tested for the base form of this product only, Presentatio: 0.01 M PBS, pH 7.4, 0.05% ProClin™ 300, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB4 / MDR3 Polyclonal RW-C735600-100
Antibody: ABCB4 / MDR3 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: MDR3 antibody RW-C735600 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for WB., Targe: Mouse ABCB4 / MDR3, Synonym: ABCB4 | ABC21 | ICP3 | GBD1 | MDR3 | MDR2 | Multidrug resistance protein 3 | Multiple drug resistance 3 | P-glycoprotein 3 | Pgy2 | PGY3 | PFIC-3 | MDR2/3, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB4, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB4., Application: Western blot
Applications tested for the base form of this product only, Presentatio: 0.01 M PBS, pH 7.4, 0.05% ProClin™ 300, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB4 / MDR: Uniprot: P21439 NCBI: NM_018849 NP_061337.1
3,781.00 € 3781.0 EUR
Rabbit anti‑Mouse ABCB11 / BSEP Polyclonal RW-C694901-100
Antibody: ABCB11 / BSEP Rabbit anti-Mouse Polyclonal (aa420-656) (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: BSEP antibody RW-C694901 is an FITC-conjugated rabbit polyclonal antibody to mouse BSEP (ABCB11) (aa420-656). Validated for WB., Targe: Mouse ABCB11 / BSEP, Synonym: ABCB11 | ABC16 | Bile salt export pump | BSEP | PGY4 | Sister p-glycoprotein | BRIC2 | PFIC-2 | PFIC2 | SPGP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCB11 (Ile420-Leu656) expressed in E. coli., Epitop: aa420-656, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB11 / BSE: Uniprot: O95342 NCBI: NM_003742 NP_003733.2
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCB11 / BSEP Polyclonal RW-C712624-100
Antibody: ABCB11 / BSEP Rabbit anti-Mouse Polyclonal (aa420-656) (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: BSEP antibody RW-C712624 is an HRP-conjugated rabbit polyclonal antibody to mouse BSEP (ABCB11) (aa420-656). Validated for WB., Targe: Mouse ABCB11 / BSEP, Synonym: ABCB11 | ABC16 | Bile salt export pump | BSEP | PGY4 | Sister p-glycoprotein | BRIC2 | PFIC-2 | PFIC2 | SPGP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCB11 (Ile420-Leu656) expressed in E. coli., Epitop: aa420-656, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB11 / BSE: Uniprot: O95342 NCBI: NM_003742 NP_003733.2
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCB11 / BSEP Polyclonal RW-C703603-100
Antibody: ABCB11 / BSEP Rabbit anti-Mouse Polyclonal (aa420-656) (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: BSEP antibody RW-C703603 is a Cy3-conjugated rabbit polyclonal antibody to mouse BSEP (ABCB11) (aa420-656). Validated for WB., Targe: Mouse ABCB11 / BSEP, Synonym: ABCB11 | ABC16 | Bile salt export pump | BSEP | PGY4 | Sister p-glycoprotein | BRIC2 | PFIC-2 | PFIC2 | SPGP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCB11 (Ile420-Leu656) expressed in E. coli., Epitop: aa420-656, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB11 / BSE: Uniprot: O95342 NCBI: NM_003742 NP_003733.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB11 / BSEP Polyclonal RW-C687991-100
Antibody: ABCB11 / BSEP Rabbit anti-Mouse Polyclonal (aa420-656) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: BSEP antibody RW-C687991 is a biotin-conjugated rabbit polyclonal antibody to mouse BSEP (ABCB11) (aa420-656). Validated for WB., Targe: Mouse ABCB11 / BSEP, Synonym: ABCB11 | ABC16 | Bile salt export pump | BSEP | PGY4 | Sister p-glycoprotein | BRIC2 | PFIC-2 | PFIC2 | SPGP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCB11 (Ile420-Leu656) expressed in E. coli., Epitop: aa420-656, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB11 / BSE: Uniprot: O95342 NCBI: NM_003742 NP_003733.2
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCB11 / BSEP Polyclonal RW-C314966-100
Antibody: ABCB11 / BSEP Rabbit anti-Mouse Polyclonal (aa420-656) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: BSEP antibody RW-C314966 is an unconjugated rabbit polyclonal antibody to mouse BSEP (ABCB11) (aa420-656). Validated for WB., Targe: Mouse ABCB11 / BSEP, Synonym: ABCB11 | ABC16 | Bile salt export pump | BSEP | PGY4 | Sister p-glycoprotein | BRIC2 | PFIC-2 | PFIC2 | SPGP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCB11 (Ile420-Leu656) expressed in E. coli., Epitop: aa420-656, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB11., Application: Western blot (1:100 - 1:400), Usag: ELISA 1:100-1:5000; ICC 1:50-500; WB 1:50-400;, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB11 / BSE: Uniprot: O95342 NCBI: NM_003742 NP_003733.2
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCB11 / BSEP Polyclonal RW-C741112-100
Antibody: ABCB11 / BSEP Rabbit anti-Mouse Polyclonal (aa420-656) (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: BSEP antibody RW-C741112 is an APC-conjugated rabbit polyclonal antibody to mouse BSEP (ABCB11) (aa420-656). Validated for WB., Targe: Mouse ABCB11 / BSEP, Synonym: ABCB11 | ABC16 | Bile salt export pump | BSEP | PGY4 | Sister p-glycoprotein | BRIC2 | PFIC-2 | PFIC2 | SPGP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCB11 (Ile420-Leu656) expressed in E. coli., Epitop: aa420-656, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB11 / BSE: Uniprot: O95342 NCBI: NM_003742 NP_003733.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB11 / BSEP Polyclonal RW-C726686-100
Antibody: ABCB11 / BSEP Rabbit anti-Mouse Polyclonal (aa420-656) (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: BSEP antibody RW-C726686 is a PE-conjugated rabbit polyclonal antibody to mouse BSEP (ABCB11) (aa420-656). Validated for WB., Targe: Mouse ABCB11 / BSEP, Synonym: ABCB11 | ABC16 | Bile salt export pump | BSEP | PGY4 | Sister p-glycoprotein | BRIC2 | PFIC-2 | PFIC2 | SPGP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCB11 (Ile420-Leu656) expressed in E. coli., Epitop: aa420-656, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB11 / BSE: Uniprot: O95342 NCBI: NM_003742 NP_003733.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB11 / BSEP Polyclonal RW-C735613-100
Antibody: ABCB11 / BSEP Rabbit anti-Mouse Polyclonal (aa420-656) (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: BSEP antibody RW-C735613 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse BSEP (ABCB11) (aa420-656). Validated for WB., Targe: Mouse ABCB11 / BSEP, Synonym: ABCB11 | ABC16 | Bile salt export pump | BSEP | PGY4 | Sister p-glycoprotein | BRIC2 | PFIC-2 | PFIC2 | SPGP, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCB11 (Ile420-Leu656) expressed in E. coli., Epitop: aa420-656, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB11., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB11 / BSE: Uniprot: O95342 NCBI: NM_003742 NP_003733.2
3,781.00 € 3781.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C694896-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCB10 antibody RW-C694896 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCB10. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB10, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB10., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C712627-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCB10 antibody RW-C712627 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCB10. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB10, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB10., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C703601-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCB10 antibody RW-C703601 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCB10. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB10, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB10., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C687987-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCB10 antibody RW-C687987 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCB10. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB10, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB10., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C663368-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCB10 antibody RW-C663368 is an unconjugated rabbit polyclonal antibody to mouse ABCB10. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB10, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB10., Application: Western blot, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C445472-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (aa194-243) (HRP) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Monkey, Rat, Bovine, Dog, Guinea pig, Pig, Rabbit, Zebrafish, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin FITC, Descriptio: ABCB10 antibody RW-C445472 is an HRP-conjugated rabbit polyclonal antibody to ABCB10 (aa194-243) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Monkey, Rat, Bovine, Dog, Guinea pig, Pig, Rabbit, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa194-243 of mouse Abcb10 (Q9JI39, NP_062425). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Dog, Bovine, Rabbit, Pig, Opossum, Guinea pig (100%); Horse, Zebra finch, Chicken, Platypus, Lizard (92%); Rice (86%); Stickleback (85%); Zebrafish, Slime mold, Grape, Spikemoss (84%)., Epitop: aa194-243, Specificit: Mouse ABCB10, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C445470-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (aa194-243) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Monkey, Rat, Bovine, Dog, Guinea pig, Pig, Rabbit, Zebrafish, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ABCB10 antibody RW-C445470 is a biotin-conjugated rabbit polyclonal antibody to ABCB10 (aa194-243) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Monkey, Rat, Bovine, Dog, Guinea pig, Pig, Rabbit, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa194-243 of mouse Abcb10 (Q9JI39, NP_062425). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Dog, Bovine, Rabbit, Pig, Opossum, Guinea pig (100%); Horse, Zebra finch, Chicken, Platypus, Lizard (92%); Rice (86%); Stickleback (85%); Zebrafish, Slime mold, Grape, Spikemoss (84%)., Epitop: aa194-243, Specificit: Mouse ABCB10, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C445471-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (aa194-243) (FITC) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Monkey, Rat, Bovine, Dog, Guinea pig, Pig, Rabbit, Zebrafish, Format: FITC, Unmodified, Other formats: Unconjugated Biotin HRP, Descriptio: ABCB10 antibody RW-C445471 is an FITC-conjugated rabbit polyclonal antibody to ABCB10 (aa194-243) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Monkey, Rat, Bovine, Dog, Guinea pig, Pig, Rabbit, Zebrafish (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa194-243 of mouse Abcb10 (Q9JI39, NP_062425). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Dog, Bovine, Rabbit, Pig, Opossum, Guinea pig (100%); Horse, Zebra finch, Chicken, Platypus, Lizard (92%); Rice (86%); Stickleback (85%); Zebrafish, Slime mold, Grape, Spikemoss (84%)., Epitop: aa194-243, Specificit: Mouse ABCB10, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C135138-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (aa194-243) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Biotin FITC HRP, Descriptio: ABCB10 antibody RW-C135138 is an unconjugated rabbit polyclonal antibody to mouse ABCB10 (aa194-243). Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa194-243 of mouse Abcb10 (Q9JI39, NP_062425). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Dog, Bovine, Rabbit, Pig, Opossum, Guinea pig (100%); Horse, Zebra finch, Chicken, Platypus, Lizard (92%); Rice (86%); Stickleback (85%); Zebrafish, Slime mold, Grape, Spikemoss (84%)., Epitop: aa194-243, Specificit: Mouse ABCB10, Application: Western blot (0.2 - 1 µg/ml), Usag: Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as secondary antibody., Presentatio: PBS, 0.09% sodium azide, 2% sucrose, Storag: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
424.00 € 424.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C741111-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCB10 antibody RW-C741111 is an APC-conjugated rabbit polyclonal antibody to mouse ABCB10. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB10, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB10., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C726682-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCB10 antibody RW-C726682 is a PE-conjugated rabbit polyclonal antibody to mouse ABCB10. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB10, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB10., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCB10 Polyclonal RW-C735610-100
Antibody: ABCB10 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCB10 antibody RW-C735610 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCB10. Validated for WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCB10, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCB10., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
3,781.00 € 3781.0 EUR
Rabbit-New Zealand White anti‑Mouse ABCB10 Polyclonal RW-C829612-100
Antibody: ABCB10 Rabbit-New Zealand White anti-Mouse Polyclonal Antibody, Application: IHC, WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: ABCB10 antibody RW-C829612 is an unconjugated rabbit-new zealand white polyclonal antibody to mouse ABCB10. Validated for IHC and WB., Targe: Mouse ABCB10, Synonym: ABCB10 | ABC-me | ABC transporter 10 protein | M-ABC2 | EST20237 | MTABC2, Hos: Rabbit-New Zealand White, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Immunoge: A synthetic peptide from aa region 300-400 of mouse ABCB10 conjugated to an immunogenic carrier protein was used as the antigen., Application: IHC (1:300 - 1:2000)
Western blot (1:300 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: Lyophilized. Whole Serum., Reconstitutio: Reconstitute in 100 ul of sterile water. Centrifuge to remove any insoluble material. Glycerol (1:1) may be added for an additional stability., Storag: Store at 2°C to 8°C for short term storage, or at -20°C for long term storage. Stable for up to 12 months after reconstitution. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1: Uniprot: Q9NRK6 NCBI: NM_012089 NP_036221.2
393.00 € 393.0 EUR
Rabbit anti‑Mouse ABCB1 / MDR1 / P Glycoprotein Polyclonal RW-C701121-200
Antibody: ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Mouse Polyclonal (aa81-321) (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: P Glycoprotein antibody RW-C701121 is a Cy3-conjugated rabbit polyclonal antibody to mouse P Glycoprotein (ABCB1 / MDR1) (aa81-321). Validated for WB., Targe: Mouse ABCB1 / MDR1 / P Glycoprotein, Synonym: ABCB1 | ABC20 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant Pgp (Leu81-Gly321) expressed in E. coli., Epitop: aa81-321, Specificit: The antibody is a rabbit polyclonal antibody raised against PGP., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1 / MDR1 / P Glycoprotei: Uniprot: P08183 NCBI: NM_000927 NP_000918.2
1,008.00 € 1008.0 EUR
Rabbit anti‑Mouse ABCB1 / MDR1 / P Glycoprotein Polyclonal RW-C710149-200
Antibody: ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Mouse Polyclonal (aa81-321) (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: P Glycoprotein antibody RW-C710149 is an HRP-conjugated rabbit polyclonal antibody to mouse P Glycoprotein (ABCB1 / MDR1) (aa81-321). Validated for WB., Targe: Mouse ABCB1 / MDR1 / P Glycoprotein, Synonym: ABCB1 | ABC20 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant Pgp (Leu81-Gly321) expressed in E. coli., Epitop: aa81-321, Specificit: The antibody is a rabbit polyclonal antibody raised against PGP., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1 / MDR1 / P Glycoprotei: Uniprot: P08183 NCBI: NM_000927 NP_000918.2
702.00 € 702.0 EUR
Rabbit anti‑Mouse ABCB1 / MDR1 / P Glycoprotein Polyclonal RW-C303741-200
Antibody: ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Mouse Polyclonal (aa81-321) (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: P Glycoprotein antibody RW-C303741 is an FITC-conjugated rabbit polyclonal antibody to mouse P Glycoprotein (ABCB1 / MDR1) (aa81-321). Validated for WB., Targe: Mouse ABCB1 / MDR1 / P Glycoprotein, Synonym: ABCB1 | ABC20 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant Pgp (Leu81-Gly321) expressed in E. coli., Epitop: aa81-321, Specificit: The antibody is a rabbit polyclonal antibody raised against PGP., Application: Western blot (1:100 - 1:400)
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, pH 7.4, 1% BSA, 0.05% proclin-300, 50% glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1 / MDR1 / P Glycoprotei: Uniprot: P08183 NCBI: NM_000927 NP_000918.2
755.00 € 755.0 EUR
Rabbit anti‑Mouse ABCB1 / MDR1 / P Glycoprotein Polyclonal RW-C300115-200
Antibody: ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Mouse Polyclonal (aa81-321) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: P Glycoprotein antibody RW-C300115 is a biotin-conjugated rabbit polyclonal antibody to mouse P Glycoprotein (ABCB1 / MDR1) (aa81-321). Validated for WB., Targe: Mouse ABCB1 / MDR1 / P Glycoprotein, Synonym: ABCB1 | ABC20 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant Pgp (Leu81-Gly321) expressed in E. coli., Epitop: aa81-321, Specificit: The antibody is a rabbit polyclonal antibody raised against PGP., Application: Western blot (1:100 - 1:400)
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1 / MDR1 / P Glycoprotei: Uniprot: P08183 NCBI: NM_000927 NP_000918.2
596.00 € 596.0 EUR
Rabbit anti‑Mouse ABCB1 / MDR1 / P Glycoprotein Polyclonal RW-C295811-100
Antibody: ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Mouse Polyclonal (aa81-321) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: P Glycoprotein antibody RW-C295811 is an unconjugated rabbit polyclonal antibody to mouse P Glycoprotein (ABCB1 / MDR1) (aa81-321). Validated for WB., Targe: Mouse ABCB1 / MDR1 / P Glycoprotein, Synonym: ABCB1 | ABC20 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant Pgp (Leu81-Gly321) expressed in E. coli., Epitop: aa81-321, Specificit: The antibody is a rabbit polyclonal antibody raised against PGP., Application: Western blot (1:100 - 1:400), Usag: ICC 5-20ug/mL; WB 0.5-2ug/mL;, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1 / MDR1 / P Glycoprotei: Uniprot: P08183 NCBI: NM_000927 NP_000918.2
1,225.00 € 1225.0 EUR
Rabbit anti‑Mouse ABCB1 / MDR1 / P Glycoprotein Polyclonal RW-C739907-200
Antibody: ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Mouse Polyclonal (aa81-321) (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: P Glycoprotein antibody RW-C739907 is an APC-conjugated rabbit polyclonal antibody to mouse P Glycoprotein (ABCB1 / MDR1) (aa81-321). Validated for WB., Targe: Mouse ABCB1 / MDR1 / P Glycoprotein, Synonym: ABCB1 | ABC20 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant Pgp (Leu81-Gly321) expressed in E. coli., Epitop: aa81-321, Specificit: The antibody is a rabbit polyclonal antibody raised against PGP., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1 / MDR1 / P Glycoprotei: Uniprot: P08183 NCBI: NM_000927 NP_000918.2
1,008.00 € 1008.0 EUR
Rabbit anti‑Mouse ABCB1 / MDR1 / P Glycoprotein Polyclonal RW-C724207-200
Antibody: ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Mouse Polyclonal (aa81-321) (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: P Glycoprotein antibody RW-C724207 is a PE-conjugated rabbit polyclonal antibody to mouse P Glycoprotein (ABCB1 / MDR1) (aa81-321). Validated for WB., Targe: Mouse ABCB1 / MDR1 / P Glycoprotein, Synonym: ABCB1 | ABC20 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant Pgp (Leu81-Gly321) expressed in E. coli., Epitop: aa81-321, Specificit: The antibody is a rabbit polyclonal antibody raised against PGP., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1 / MDR1 / P Glycoprotei: Uniprot: P08183 NCBI: NM_000927 NP_000918.2
1,008.00 € 1008.0 EUR
Rabbit anti‑Mouse ABCB1 / MDR1 / P Glycoprotein Polyclonal RW-C733196-1
Antibody: ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Mouse Polyclonal (aa81-321) (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: P Glycoprotein antibody RW-C733196 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse P Glycoprotein (ABCB1 / MDR1) (aa81-321). Validated for WB., Targe: Mouse ABCB1 / MDR1 / P Glycoprotein, Synonym: ABCB1 | ABC20 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant Pgp (Leu81-Gly321) expressed in E. coli., Epitop: aa81-321, Specificit: The antibody is a rabbit polyclonal antibody raised against PGP., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB1 / MDR1 / P Glycoprotei: Uniprot: P08183 NCBI: NM_000927 NP_000918.2
1,401.00 € 1401.0 EUR
Rabbit anti‑Mouse ABCA9 Polyclonal RW-C694909-100
Antibody: ABCA9 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCA9 antibody RW-C694909 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCA9. Validated for WB., Targe: Mouse ABCA9, Synonym: ABCA9 | ATP-binding cassette A9 | ABC-A9 | EST640918, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IUA7 NCBI: NM_080283 NP_525022.2
1,941.00 € 1941.0 EUR
Rabbit anti‑Mouse ABCA9 Polyclonal RW-C712636-100
Antibody: ABCA9 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCA9 antibody RW-C712636 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCA9. Validated for WB., Targe: Mouse ABCA9, Synonym: ABCA9 | ATP-binding cassette A9 | ABC-A9 | EST640918, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IUA7 NCBI: NM_080283 NP_525022.2
1,803.00 € 1803.0 EUR
Rabbit anti‑Mouse ABCA9 Polyclonal RW-C703611-100
Antibody: ABCA9 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCA9 antibody RW-C703611 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCA9. Validated for WB., Targe: Mouse ABCA9, Synonym: ABCA9 | ATP-binding cassette A9 | ABC-A9 | EST640918, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IUA7 NCBI: NM_080283 NP_525022.2
2,773.00 € 2773.0 EUR
Rabbit anti‑Mouse ABCA9 Polyclonal RW-C688001-100
Antibody: ABCA9 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCA9 antibody RW-C688001 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCA9. Validated for WB., Targe: Mouse ABCA9, Synonym: ABCA9 | ATP-binding cassette A9 | ABC-A9 | EST640918, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IUA7 NCBI: NM_080283 NP_525022.2
1,525.00 € 1525.0 EUR
Rabbit anti‑Mouse ABCA9 Polyclonal RW-C663949-100
Antibody: ABCA9 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCA9 antibody RW-C663949 is an unconjugated rabbit polyclonal antibody to mouse ABCA9. Validated for WB., Targe: Mouse ABCA9, Synonym: ABCA9 | ATP-binding cassette A9 | ABC-A9 | EST640918, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA9., Application: Western blot, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IUA7 NCBI: NM_080283 NP_525022.2
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCA9 Polyclonal RW-C741121-100
Antibody: ABCA9 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCA9 antibody RW-C741121 is an APC-conjugated rabbit polyclonal antibody to mouse ABCA9. Validated for WB., Targe: Mouse ABCA9, Synonym: ABCA9 | ATP-binding cassette A9 | ABC-A9 | EST640918, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IUA7 NCBI: NM_080283 NP_525022.2
2,773.00 € 2773.0 EUR
Rabbit anti‑Mouse ABCA9 Polyclonal RW-C726697-100
Antibody: ABCA9 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCA9 antibody RW-C726697 is a PE-conjugated rabbit polyclonal antibody to mouse ABCA9. Validated for WB., Targe: Mouse ABCA9, Synonym: ABCA9 | ATP-binding cassette A9 | ABC-A9 | EST640918, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IUA7 NCBI: NM_080283 NP_525022.2
2,773.00 € 2773.0 EUR
Rabbit anti‑Mouse ABCA9 Polyclonal RW-C735622-100
Antibody: ABCA9 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCA9 antibody RW-C735622 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCA9. Validated for WB., Targe: Mouse ABCA9, Synonym: ABCA9 | ATP-binding cassette A9 | ABC-A9 | EST640918, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA9, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA9., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IUA7 NCBI: NM_080283 NP_525022.2
4,159.00 € 4159.0 EUR
Rabbit anti‑Mouse ABCA8 Polyclonal RW-C694906-100
Antibody: ABCA8 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCA8 antibody RW-C694906 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCA8. Validated for WB., Targe: Mouse ABCA8, Synonym: ABCA8 | KIAA0822, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O94911 NCBI: NM_007168 NP_009099.1
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCA8 Polyclonal RW-C712635-100
Antibody: ABCA8 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCA8 antibody RW-C712635 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCA8. Validated for WB., Targe: Mouse ABCA8, Synonym: ABCA8 | KIAA0822, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O94911 NCBI: NM_007168 NP_009099.1
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCA8 Polyclonal RW-C703607-100
Antibody: ABCA8 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCA8 antibody RW-C703607 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCA8. Validated for WB., Targe: Mouse ABCA8, Synonym: ABCA8 | KIAA0822, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O94911 NCBI: NM_007168 NP_009099.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA8 Polyclonal RW-C687999-100
Antibody: ABCA8 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCA8 antibody RW-C687999 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCA8. Validated for WB., Targe: Mouse ABCA8, Synonym: ABCA8 | KIAA0822, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O94911 NCBI: NM_007168 NP_009099.1
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCA8 Polyclonal RW-C663375-100
Antibody: ABCA8 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCA8 antibody RW-C663375 is an unconjugated rabbit polyclonal antibody to mouse ABCA8. Validated for WB., Targe: Mouse ABCA8, Synonym: ABCA8 | KIAA0822, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA8., Application: Western blot, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O94911 NCBI: NM_007168 NP_009099.1
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCA8 Polyclonal RW-C741117-100
Antibody: ABCA8 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCA8 antibody RW-C741117 is an APC-conjugated rabbit polyclonal antibody to mouse ABCA8. Validated for WB., Targe: Mouse ABCA8, Synonym: ABCA8 | KIAA0822, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O94911 NCBI: NM_007168 NP_009099.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA8 Polyclonal RW-C726693-100
Antibody: ABCA8 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCA8 antibody RW-C726693 is a PE-conjugated rabbit polyclonal antibody to mouse ABCA8. Validated for WB., Targe: Mouse ABCA8, Synonym: ABCA8 | KIAA0822, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O94911 NCBI: NM_007168 NP_009099.1
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA8 Polyclonal RW-C735621-100
Antibody: ABCA8 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCA8 antibody RW-C735621 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCA8. Validated for WB., Targe: Mouse ABCA8, Synonym: ABCA8 | KIAA0822, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA8, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA8., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O94911 NCBI: NM_007168 NP_009099.1
3,781.00 € 3781.0 EUR
Rat anti‑Mouse ABCA7 IgG2a,k Monoclonal RW-C141538-0.1
Antibody: ABCA7 Rat anti-Mouse Monoclonal (DY550) (7A1-144) Antibody, Application: IHC, IHC-P, WB, Flo, Reactivity: Mouse, Format: DyLight 550, Unmodified, Other formats: Biotin DY650 DY488, Descriptio: ABCA7 antibody RW-C141538 is a DY550-conjugated rat monoclonal antibody to mouse ABCA7. Validated for Flow, IHC and WB., Targe: Mouse ABCA7, Synonym: ABCA7 | ABCA-SSN | Autoantigen SS-N | ABCX | Macrophage ABC transporter, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a,k Monoclonal, Clon: 7A1-144, Conjugation: DyLight 550. Also available conjugated with Biotin, DY650, DY488., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Mouse ABCA7 stably-transfected HeLa cells, Specificit: ABCA7., Application: IHC
IHC - Paraffin
Western blot (1:2000)
Flow Cytometry (1:500 - 1:4000)
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 50 mM sodium borate, Storag: Store at 4°C. Do not freeze., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IZY2 NCBI: NM_019112 NP_061985.2
416.00 € 416.0 EUR
Rat anti‑Mouse ABCA7 IgG2a,k Monoclonal RW-C141535-0.1
Antibody: ABCA7 Rat anti-Mouse Monoclonal (DY650) (7A1-144) Antibody, Application: IHC, IHC-P, WB, Flo, Reactivity: Mouse, Format: DyLight 650, Unmodified, Other formats: Biotin DY488 DY550, Descriptio: ABCA7 antibody RW-C141535 is a DY650-conjugated rat monoclonal antibody to mouse ABCA7. Validated for Flow, IHC and WB., Targe: Mouse ABCA7, Synonym: ABCA7 | ABCA-SSN | Autoantigen SS-N | ABCX | Macrophage ABC transporter, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a,k Monoclonal, Clon: 7A1-144, Conjugation: DyLight 650. Also available conjugated with Biotin, DY488, DY550., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Mouse ABCA7 stably-transfected HeLa cells, Specificit: ABCA7., Application: IHC
IHC - Paraffin
Western blot (1:2000)
Flow Cytometry (1:500 - 1:4000)
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 50 mM sodium borate, Storag: Store at 4°C. Do not freeze., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IZY2 NCBI: NM_019112 NP_061985.2
416.00 € 416.0 EUR
Rat anti‑Mouse ABCA7 IgG2a,k Monoclonal RW-C141536-0.1
Antibody: ABCA7 Rat anti-Mouse Monoclonal (DY488) (7A1-144) Antibody, Application: IHC, IHC-P, WB, Flo, Reactivity: Mouse, Format: DyLight 488, Unmodified, Other formats: Biotin DY650 DY550, Descriptio: ABCA7 antibody RW-C141536 is a DY488-conjugated rat monoclonal antibody to mouse ABCA7. Validated for Flow, IHC and WB., Targe: Mouse ABCA7, Synonym: ABCA7 | ABCA-SSN | Autoantigen SS-N | ABCX | Macrophage ABC transporter, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a,k Monoclonal, Clon: 7A1-144, Conjugation: DyLight 488. Also available conjugated with Biotin, DY650, DY550., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Mouse ABCA7 stably-transfected HeLa cells, Specificit: ABCA7., Application: IHC
IHC - Paraffin
Western blot (1:2000)
Flow Cytometry (1:500 - 1:4000)
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 50 mM sodium borate, Storag: Store at 4°C. Do not freeze., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IZY2 NCBI: NM_019112 NP_061985.2
416.00 € 416.0 EUR
Rat anti‑Mouse ABCA7 IgG2a,k Monoclonal RW-C141534-0.1
Antibody: ABCA7 Rat anti-Mouse Monoclonal (Biotin) (7A1-144) Antibody, Application: IHC, IHC-P, WB, Flo, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: DY650 DY488 DY550, Descriptio: ABCA7 antibody RW-C141534 is a biotin-conjugated rat monoclonal antibody to mouse ABCA7. Validated for Flow, IHC and WB., Targe: Mouse ABCA7, Synonym: ABCA7 | ABCA-SSN | Autoantigen SS-N | ABCX | Macrophage ABC transporter, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a,k Monoclonal, Clon: 7A1-144, Conjugation: Biotin. Also available conjugated with DY650, DY488, DY550., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Mouse ABCA7 stably-transfected HeLa cells, Specificit: ABCA7., Application: IHC
IHC - Paraffin
Western blot (1:2000)
Flow Cytometry (1:500 - 1:4000)
Applications tested for the base form of this product only, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Store at 4°C. Do not freeze., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IZY2 NCBI: NM_019112 NP_061985.2
416.00 € 416.0 EUR
Rat anti‑Mouse ABCA7 IgG2a,k Monoclonal RW-C2754-0.1
Antibody: ABCA7 Rat anti-Mouse Monoclonal (7A1-144) Antibody, Application: WB, Flo, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: ABCA7 antibody RW-C2754 is an unconjugated rat monoclonal antibody to mouse ABCA7. Validated for Flow and WB., Targe: Mouse ABCA7, Synonym: ABCA7 | ABCA-SSN | Autoantigen SS-N | ABCX | Macrophage ABC transporter, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a,k Monoclonal, Clon: 7A1-144, Conjugation: Unconjugated, Purificatio: Ascites, Modification: Unmodified, Immunoge: Mouse ABCA7 stably-transfected HeLa cells, Specificit: ABCA7., Application: Western blot (1:2000 - 1:8000)
Flow Cytometry, Presentatio: 0.1% Sodium Azide, Storag: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IZY2 NCBI: NM_019112 NP_061985.2
386.00 € 386.0 EUR
Rabbit-New Zealand White anti‑Mouse ABCA7 Polyclonal RW-C829684-100
Antibody: ABCA7 Rabbit-New Zealand White anti-Mouse Polyclonal (aa2100-2155) Antibody, Application: IHC, WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: ABCA7 antibody RW-C829684 is an unconjugated rabbit-new zealand white polyclonal antibody to mouse ABCA7 (aa2100-2155). Validated for IHC and WB., Targe: Mouse ABCA7, Synonym: ABCA7 | ABCA-SSN | Autoantigen SS-N | ABCX | Macrophage ABC transporter, Hos: Rabbit-New Zealand White, Reactivit: Mouse (tested or 100% immunogen sequence identity), Predicte: Rat (at least 90% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Immunoge: A synthetic peptide from aa region 2100-2155 of mouse ABCA7 conjugated to blue carrier protein was used as the antigen. The peptide shares about 93% identity with rat sequence., Epitop: aa2100-2155, Application: IHC (1:300 - 1:2000)
Western blot (1:300 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Applications should be user optimized., Presentatio: Lyophilized. Whole Serum., Reconstitutio: Reconstitute in 100 ul of sterile water. Centrifuge to remove any insoluble material. Glycerol (1:1) may be added for an additional stability., Storag: Store at 2°C to 8°C for short term storage, or at -20°C for long term storage. Stable for up to 12 months after reconstitution. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8IZY2 NCBI: NM_019112 NP_061985.2
393.00 € 393.0 EUR
Rabbit anti‑Mouse ABCA6 Polyclonal RW-C694905-100
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCA6 antibody RW-C694905 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCA6. Validated for WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCA6 Polyclonal RW-C712629-100
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCA6 antibody RW-C712629 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCA6. Validated for WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCA6 Polyclonal RW-C703608-100
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCA6 antibody RW-C703608 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCA6. Validated for WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA6 Polyclonal RW-C687994-100
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCA6 antibody RW-C687994 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCA6. Validated for WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCA6 Polyclonal RW-C663372-100
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCA6 antibody RW-C663372 is an unconjugated rabbit polyclonal antibody to mouse ABCA6. Validated for WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA6., Application: Western blot, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCA6 IgG Polyclonal RW-C335309-20
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal Antibody, Application: IHC, WB, Reactivity: Mouse, Human, Rat, Format: Unconjugated, Unmodified, Descriptio: ABCA6 antibody RW-C335309 is an unconjugated rabbit polyclonal antibody to ABCA6 from mouse. It is reactive with human, mouse and rat. Validated for IHC and WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse, Human, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant protein of mouse ABCA6, Specificit: Mouse ABCA6, Application: IHC (1:50 - 1:200)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 44kDa/183kDa, while the observed MW by Western blot was 183kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
503.00 € 503.0 EUR
Rabbit anti‑Mouse ABCA6 IgG Polyclonal RW-C834189-60
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal Antibody, Application: IHC, WB, Reactivity: Mouse, Human, Rat, Format: Unconjugated, Unmodified, Descriptio: ABCA6 antibody RW-C834189 is an unconjugated rabbit polyclonal antibody to ABCA6 from mouse. It is reactive with human, mouse and rat. Validated for IHC and WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse, Human, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purification, Modification: Unmodified, Immunoge: Recombinant protein of mouse ABCA6, Application: IHC (1:50 - 1:200)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
529.00 € 529.0 EUR
Rabbit anti‑Mouse ABCA6 Polyclonal RW-C741115-100
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCA6 antibody RW-C741115 is an APC-conjugated rabbit polyclonal antibody to mouse ABCA6. Validated for WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA6 Polyclonal RW-C726691-100
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCA6 antibody RW-C726691 is a PE-conjugated rabbit polyclonal antibody to mouse ABCA6. Validated for WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA6 Polyclonal RW-C735618-100
Antibody: ABCA6 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCA6 antibody RW-C735618 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCA6. Validated for WB., Targe: Mouse ABCA6, Synonym: ABCA6 | ABC transporter ABCA6 | ATP-binding cassette A6 | EST155051, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA6, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA6., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8N139 NCBI: NM_080284 NP_525023.2
3,781.00 € 3781.0 EUR
Rabbit anti‑Mouse ABCA5 Polyclonal RW-C694908-100
Antibody: ABCA5 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCA5 antibody RW-C694908 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCA5. Validated for WB., Targe: Mouse ABCA5, Synonym: ABCA5 | ATP-binding cassette A5 | ABC13 | EST90625 | KIAA1888, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA5, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA5., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8WWZ7 NCBI: NM_018672 NP_061142.2
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCA5 Polyclonal RW-C712630-100
Antibody: ABCA5 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCA5 antibody RW-C712630 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCA5. Validated for WB., Targe: Mouse ABCA5, Synonym: ABCA5 | ATP-binding cassette A5 | ABC13 | EST90625 | KIAA1888, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA5, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA5., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8WWZ7 NCBI: NM_018672 NP_061142.2
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCA5 Polyclonal RW-C703606-100
Antibody: ABCA5 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCA5 antibody RW-C703606 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCA5. Validated for WB., Targe: Mouse ABCA5, Synonym: ABCA5 | ATP-binding cassette A5 | ABC13 | EST90625 | KIAA1888, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA5, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA5., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8WWZ7 NCBI: NM_018672 NP_061142.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA5 Polyclonal RW-C687992-100
Antibody: ABCA5 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCA5 antibody RW-C687992 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCA5. Validated for WB., Targe: Mouse ABCA5, Synonym: ABCA5 | ATP-binding cassette A5 | ABC13 | EST90625 | KIAA1888, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA5, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA5., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8WWZ7 NCBI: NM_018672 NP_061142.2
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCA5 Polyclonal RW-C663373-100
Antibody: ABCA5 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCA5 antibody RW-C663373 is an unconjugated rabbit polyclonal antibody to mouse ABCA5. Validated for WB., Targe: Mouse ABCA5, Synonym: ABCA5 | ATP-binding cassette A5 | ABC13 | EST90625 | KIAA1888, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA5, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA5., Application: Western blot, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8WWZ7 NCBI: NM_018672 NP_061142.2
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCA5 Polyclonal RW-C741114-100
Antibody: ABCA5 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCA5 antibody RW-C741114 is an APC-conjugated rabbit polyclonal antibody to mouse ABCA5. Validated for WB., Targe: Mouse ABCA5, Synonym: ABCA5 | ATP-binding cassette A5 | ABC13 | EST90625 | KIAA1888, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA5, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA5., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8WWZ7 NCBI: NM_018672 NP_061142.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA5 Polyclonal RW-C726694-100
Antibody: ABCA5 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCA5 antibody RW-C726694 is a PE-conjugated rabbit polyclonal antibody to mouse ABCA5. Validated for WB., Targe: Mouse ABCA5, Synonym: ABCA5 | ATP-binding cassette A5 | ABC13 | EST90625 | KIAA1888, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA5, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA5., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8WWZ7 NCBI: NM_018672 NP_061142.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA5 Polyclonal RW-C735617-100
Antibody: ABCA5 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCA5 antibody RW-C735617 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCA5. Validated for WB., Targe: Mouse ABCA5, Synonym: ABCA5 | ATP-binding cassette A5 | ABC13 | EST90625 | KIAA1888, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA5, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA5., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q8WWZ7 NCBI: NM_018672 NP_061142.2
3,781.00 € 3781.0 EUR
Rabbit anti‑Mouse ABCA4 Polyclonal RW-C313193-10
Antibody: ABCA4 Rabbit anti-Mouse Polyclonal (aa1892-1903) Antibody, Application: WB, Reactivity: Mouse, Rat, Bat, Guinea pig, Rabbit, Format: Unconjugated, Unmodified, Descriptio: ABCA4 antibody RW-C313193 is an unconjugated rabbit polyclonal antibody to ABCA4 (aa1892-1903) from mouse. It is reactive with mouse, rat, bat and other species. Validated for WB., Targe: Mouse ABCA4, Synonym: ABCA4 | ABCR | ABC10 | ARMD2 | CORD3 | FFM | RIM ABC transporter | RIM protein | RMP | RP19 | STGD | Photoreceptor rim protein | Stargardt disease protein | STGD1, Hos: Rabbit, Reactivit: Mouse, Rat, Bat, Guinea pig, Rabbit (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the C-Terminus of mouse ABCA4(1892-1903 aa TLLIQHHFFLTR), identical to the related rat sequence., Epitop: aa1892-1903, Specificit: Retinal-specific. Seems to be exclusively found in the rims of rod photoreceptor cells., Application: Western blot, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Thimerosal, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: P78363 NCBI: NM_000350 NP_000341.2
470.00 € 470.0 EUR
Rabbit anti‑Mouse ABCA4 IgG Polyclonal RW-C782804-100
Antibody: ABCA4 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ABCA4 antibody RW-C782804 is an unconjugated rabbit polyclonal antibody to ABCA4 from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCA4, Synonym: ABCA4 | ABCR | ABC10 | ARMD2 | CORD3 | FFM | RIM ABC transporter | RIM protein | RMP | RP19 | STGD | Photoreceptor rim protein | Stargardt disease protein | STGD1, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Predicte: Human (at least 90% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Antigen Affinity purification, Modification: Unmodified, Immunoge: Amino acids 1890-1927 (FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR) from the human protein were used as the immunogen for the ABCA4 antibody., Application: Western blot (0.5 - 1 µg/ml), Usag: Optimal dilution of the ABCA4 antibody should be determined by the researcher., Presentatio: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide., Reconstitutio: Reconstitute with 0.2ml distilled water, Storag: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: P78363 NCBI: NM_000350 NP_000341.2
575.00 € 575.0 EUR
Rabbit anti‑Mouse ABCA2 Polyclonal RW-C694877-100
Antibody: ABCA2 Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCA2 antibody RW-C694877 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCA2. Validated for WB., Targe: Mouse ABCA2, Synonym: ABCA2 | ATP-binding cassette 2 | ABC2 | KIAA1062, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA2, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA2., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q9BZC7 NCBI: NM_001606 NP_001597.2
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCA2 Polyclonal RW-C712601-100
Antibody: ABCA2 Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCA2 antibody RW-C712601 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCA2. Validated for WB., Targe: Mouse ABCA2, Synonym: ABCA2 | ATP-binding cassette 2 | ABC2 | KIAA1062, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA2, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA2., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q9BZC7 NCBI: NM_001606 NP_001597.2
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCA2 Polyclonal RW-C703580-100
Antibody: ABCA2 Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCA2 antibody RW-C703580 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCA2. Validated for WB., Targe: Mouse ABCA2, Synonym: ABCA2 | ATP-binding cassette 2 | ABC2 | KIAA1062, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA2, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA2., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q9BZC7 NCBI: NM_001606 NP_001597.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA2 Polyclonal RW-C687965-100
Antibody: ABCA2 Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCA2 antibody RW-C687965 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCA2. Validated for WB., Targe: Mouse ABCA2, Synonym: ABCA2 | ATP-binding cassette 2 | ABC2 | KIAA1062, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA2, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA2., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q9BZC7 NCBI: NM_001606 NP_001597.2
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCA2 Polyclonal RW-C663357-100
Antibody: ABCA2 Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCA2 antibody RW-C663357 is an unconjugated rabbit polyclonal antibody to mouse ABCA2. Validated for WB., Targe: Mouse ABCA2, Synonym: ABCA2 | ATP-binding cassette 2 | ABC2 | KIAA1062, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA2, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA2., Application: Western blot, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q9BZC7 NCBI: NM_001606 NP_001597.2
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCA2 Polyclonal RW-C741101-100
Antibody: ABCA2 Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCA2 antibody RW-C741101 is an APC-conjugated rabbit polyclonal antibody to mouse ABCA2. Validated for WB., Targe: Mouse ABCA2, Synonym: ABCA2 | ATP-binding cassette 2 | ABC2 | KIAA1062, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA2, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA2., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q9BZC7 NCBI: NM_001606 NP_001597.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA2 Polyclonal RW-C726663-100
Antibody: ABCA2 Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCA2 antibody RW-C726663 is a PE-conjugated rabbit polyclonal antibody to mouse ABCA2. Validated for WB., Targe: Mouse ABCA2, Synonym: ABCA2 | ATP-binding cassette 2 | ABC2 | KIAA1062, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA2, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA2., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q9BZC7 NCBI: NM_001606 NP_001597.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA2 Polyclonal RW-C735588-100
Antibody: ABCA2 Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCA2 antibody RW-C735588 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCA2. Validated for WB., Targe: Mouse ABCA2, Synonym: ABCA2 | ATP-binding cassette 2 | ABC2 | KIAA1062, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABCA2, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA2., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: Q9BZC7 NCBI: NM_001606 NP_001597.2
3,781.00 € 3781.0 EUR
Rabbit anti‑Mouse ABCA13 Polyclonal RW-C694912-100
Antibody: ABCA13 Rabbit anti-Mouse Polyclonal (aa4692-4931) (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCA13 antibody RW-C694912 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCA13 (aa4692-4931). Validated for WB., Targe: Mouse ABCA13, Synonym: ABCA13, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA13 (Met4692-Trp4931), Epitop: aa4692-4931, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA13., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA1: Uniprot: Q86UQ4 NCBI: NM_152701 NP_689914.3
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABCA13 Polyclonal RW-C712641-100
Antibody: ABCA13 Rabbit anti-Mouse Polyclonal (aa4692-4931) (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCA13 antibody RW-C712641 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCA13 (aa4692-4931). Validated for WB., Targe: Mouse ABCA13, Synonym: ABCA13, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA13 (Met4692-Trp4931), Epitop: aa4692-4931, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA13., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA1: Uniprot: Q86UQ4 NCBI: NM_152701 NP_689914.3
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABCA13 Polyclonal RW-C703615-100
Antibody: ABCA13 Rabbit anti-Mouse Polyclonal (aa4692-4931) (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCA13 antibody RW-C703615 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCA13 (aa4692-4931). Validated for WB., Targe: Mouse ABCA13, Synonym: ABCA13, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA13 (Met4692-Trp4931), Epitop: aa4692-4931, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA13., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA1: Uniprot: Q86UQ4 NCBI: NM_152701 NP_689914.3
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA13 Polyclonal RW-C688005-100
Antibody: ABCA13 Rabbit anti-Mouse Polyclonal (aa4692-4931) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCA13 antibody RW-C688005 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCA13 (aa4692-4931). Validated for WB., Targe: Mouse ABCA13, Synonym: ABCA13, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA13 (Met4692-Trp4931), Epitop: aa4692-4931, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA13., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA1: Uniprot: Q86UQ4 NCBI: NM_152701 NP_689914.3
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABCA13 Polyclonal RW-C373172-100
Antibody: ABCA13 Rabbit anti-Mouse Polyclonal (aa4692-4931) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCA13 antibody RW-C373172 is an unconjugated rabbit polyclonal antibody to mouse ABCA13 (aa4692-4931). Validated for WB. Cited in 1 publication., Targe: Mouse ABCA13, Synonym: ABCA13, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA13 (Met4692-Trp4931), Epitop: aa4692-4931, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA13., Application: Western blot (1:50 - 1:400), Usag: ELISA 0.05-2ug/ml; ICC 5-20ug/ml; WB 0.5-2ug/ml;, Presentatio: 0.01 M PBS, pH 7.4, 0.05% ProClin™ 300, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA1: Uniprot: Q86UQ4 NCBI: NM_152701 NP_689914.3
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABCA13 Polyclonal RW-C741124-100
Antibody: ABCA13 Rabbit anti-Mouse Polyclonal (aa4692-4931) (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCA13 antibody RW-C741124 is an APC-conjugated rabbit polyclonal antibody to mouse ABCA13 (aa4692-4931). Validated for WB., Targe: Mouse ABCA13, Synonym: ABCA13, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA13 (Met4692-Trp4931), Epitop: aa4692-4931, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA13., Application: Western blot
Applications tested for the base form of this product only, Presentatio: 10mM Tris, 150mM NaCl, pH 8.2, 50% glycerol, 0.05% proclin-300, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA1: Uniprot: Q86UQ4 NCBI: NM_152701 NP_689914.3
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA13 Polyclonal RW-C726700-100
Antibody: ABCA13 Rabbit anti-Mouse Polyclonal (aa4692-4931) (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCA13 antibody RW-C726700 is a PE-conjugated rabbit polyclonal antibody to mouse ABCA13 (aa4692-4931). Validated for WB., Targe: Mouse ABCA13, Synonym: ABCA13, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA13 (Met4692-Trp4931), Epitop: aa4692-4931, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA13., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA1: Uniprot: Q86UQ4 NCBI: NM_152701 NP_689914.3
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABCA13 Polyclonal RW-C735623-100
Antibody: ABCA13 Rabbit anti-Mouse Polyclonal (aa4692-4931) (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCA13 antibody RW-C735623 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCA13 (aa4692-4931). Validated for WB., Targe: Mouse ABCA13, Synonym: ABCA13, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA13 (Met4692-Trp4931), Epitop: aa4692-4931, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA13., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA1: Uniprot: Q86UQ4 NCBI: NM_152701 NP_689914.3
3,781.00 € 3781.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C709296-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1404-1663) (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABCA1 antibody RW-C709296 is an HRP-conjugated rabbit polyclonal antibody to mouse ABCA1 (aa1404-1663). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA1 (Leu1404-Phe1663) expressed in E. coli., Epitop: aa1404-1663, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA1., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
1,557.00 € 1557.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C700272-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1404-1663) (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABCA1 antibody RW-C700272 is a Cy3-conjugated rabbit polyclonal antibody to mouse ABCA1 (aa1404-1663). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA1 (Leu1404-Phe1663) expressed in E. coli., Epitop: aa1404-1663, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA1., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
2,395.00 € 2395.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C692140-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1404-1663) (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABCA1 antibody RW-C692140 is an FITC-conjugated rabbit polyclonal antibody to mouse ABCA1 (aa1404-1663). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA1 (Leu1404-Phe1663) expressed in E. coli., Epitop: aa1404-1663, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA1., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
1,676.00 € 1676.0 EUR
Rat anti‑Mouse ABCA1 IgG2a Monoclonal RW-C523128-100
Antibody: ABCA1 Rat anti-Mouse Monoclonal (Biotin) Antibody, Application: IF, WB, Flo, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Unconjugated HRP, Descriptio: ABCA1 antibody RW-C523128 is a biotin-conjugated rat monoclonal antibody to mouse ABCA1. Validated for Flow, IF and WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a Monoclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with HRP., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: ABCA1 transfected HeLa cells., Specificit: Recognizes murine adenosine triphosphate (ATP) Binding cassette transporter 1 (ABCA1)., Application: Immunofluorescence
Western blot
Flow Cytometry
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.2, Storag: Store at 4°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
973.00 € 973.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C685633-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1404-1663) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABCA1 antibody RW-C685633 is a biotin-conjugated rabbit polyclonal antibody to mouse ABCA1 (aa1404-1663). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA1 (Leu1404-Phe1663) expressed in E. coli., Epitop: aa1404-1663, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA1., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
1,317.00 € 1317.0 EUR
Rat anti‑Mouse ABCA1 IgG2a Monoclonal RW-C543259-100
Antibody: ABCA1 Rat anti-Mouse Monoclonal (HRP) Antibody, Application: IF, WB, Flo, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated Biotin, Descriptio: ABCA1 antibody RW-C543259 is an HRP-conjugated rat monoclonal antibody to mouse ABCA1. Validated for Flow, IF and WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a Monoclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: ABCA1 transfected HeLa cells., Specificit: Recognizes murine adenosine triphosphate (ATP) Binding cassette transporter 1 (ABCA1)., Application: Immunofluorescence
Western blot
Flow Cytometry
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.2, Storag: Store at 4°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
973.00 € 973.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C445449-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1271-1320) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Rat, Dog, Guinea pig, Format: Biotin, Unmodified, Other formats: Unconjugated FITC HRP, Descriptio: ABCA1 antibody RW-C445449 is a biotin-conjugated rabbit polyclonal antibody to ABCA1 (aa1271-1320) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Rat, Dog, Guinea pig (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa1271-1320 of mouse Abca1 (B1AWZ8, NP_038482). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse (100%); Galago, Marmoset, Bovine, Bat, Rabbit, Horse, Pig, Turkey, Zebra finch, Chicken (92%); Monkey, Rat, Hamster, Elephant, Dog, Guinea pig, Lizard (85%); Platypus (80%)., Epitop: aa1271-1320, Specificit: Mouse ABCA1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C445343-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1271-1320) (HRP) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Rat, Dog, Guinea pig, Format: Horseradish Peroxidase, Unmodified, Other formats: Unconjugated FITC Biotin, Descriptio: ABCA1 antibody RW-C445343 is an HRP-conjugated rabbit polyclonal antibody to ABCA1 (aa1271-1320) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Rat, Dog, Guinea pig (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with FITC, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa1271-1320 of mouse Abca1 (B1AWZ8, NP_038482). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse (100%); Galago, Marmoset, Bovine, Bat, Rabbit, Horse, Pig, Turkey, Zebra finch, Chicken (92%); Monkey, Rat, Hamster, Elephant, Dog, Guinea pig, Lizard (85%); Platypus (80%)., Epitop: aa1271-1320, Specificit: Mouse ABCA1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: 100 mM sodium phosphate, pH 7.6, 150 mM NaCl, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C445342-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1271-1320) (FITC) Antibody, Application: WB, Reactivity: Mouse, Human, Gibbon, Rat, Dog, Guinea pig, Format: FITC, Unmodified, Other formats: Unconjugated HRP Biotin, Descriptio: ABCA1 antibody RW-C445342 is an FITC-conjugated rabbit polyclonal antibody to ABCA1 (aa1271-1320) from mouse. It is reactive with human, mouse, rat and other species. Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse, Human, Gibbon, Rat, Dog, Guinea pig (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with HRP, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa1271-1320 of mouse Abca1 (B1AWZ8, NP_038482). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse (100%); Galago, Marmoset, Bovine, Bat, Rabbit, Horse, Pig, Turkey, Zebra finch, Chicken (92%); Monkey, Rat, Hamster, Elephant, Dog, Guinea pig, Lizard (85%); Platypus (80%)., Epitop: aa1271-1320, Specificit: Mouse ABCA1, Application: Western blot
Applications tested for the base form of this product only, Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, Storag: Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
469.00 € 469.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C292953-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1404-1663) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABCA1 antibody RW-C292953 is an unconjugated rabbit polyclonal antibody to mouse ABCA1 (aa1404-1663). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA1 (Leu1404-Phe1663) expressed in E. coli., Epitop: aa1404-1663, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA1., Application: Western blot (1:100 - 1:400), Usag: ELISA 1:100-1:5000; ICC 1:50-500; WB 1:50-400;, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
1,206.00 € 1206.0 EUR
Rat anti‑Mouse ABCA1 IgG1 Monoclonal RW-C188427-0.1
Antibody: ABCA1 Rat anti-Mouse Monoclonal (aa215-233) (FITC) (3A1-891.3) Antibody, Application: Flo, Reactivity: Mouse, Format: FITC, Unmodified, Descriptio: ABCA1 antibody RW-C188427 is an FITC-conjugated rat monoclonal antibody to mouse ABCA1 (aa215-233). Validated for Flow., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG1 Monoclonal, Clon: 3A1-891.3, Conjugation: FITC, Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Synthetic peptide corresponding to aa 215-233., Epitop: aa215-233, Specificit: Recognizes murine adenosine triphosphate (ATP) Binding cassette transporter 1 (ABCA1). The ABC transporters are a large family of conserved proteins that transport a wide variety of molecules across cellular membranes. ABCA1 is a member of the ABC-A sub-family, which acts as a lipid translocator. The molecule was originally identified as a scavenger receptor on macrophages and research shows that ABCA1 also plays a major role in cholesterol metabolism. ABCA1 may play an important role in protecting against cardiovascular disease. Mutations in ABCA1 gene have been associated with Tangiers disease, a genetic disorder of lipid metabolism, and familial high density lipoprotein (HDL) deficiency., Application: Flow Cytometry (1:1 - 1:10), Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, 0.09% Sodium Azide, 1% BSA, Storag: Store at 4°C or at -20°C. Store undiluted. Avoid freeze-thaw cycles. Protect from light. Microcentrifugation recommended if solution contains precipitate., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
412.00 € 412.0 EUR
Rat anti‑Mouse ABCA1 IgG2a Monoclonal RW-C188369-100
Antibody: ABCA1 Rat anti-Mouse Monoclonal (RPE) (5A1-1422) Antibody, Application: Flo, Reactivity: Mouse, Format: R. Phycoerythrin, Unmodified, Descriptio: ABCA1 antibody RW-C188369 is an RPE-conjugated rat monoclonal antibody to mouse ABCA1. Validated for Flow., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a Monoclonal, Clon: 5A1-1422, Conjugation: R. Phycoerythrin, Purificatio: Protein G purified, Modification: Unmodified, Immunoge: ABCA1 transfected HeLa cells., Specificit: Recognizes murine adenosine triphosphate (ATP) Binding cassette transporter 1 (ABCA1). The ABC transporters are a large family of conserved proteins that transport a wide variety of molecules across cellular membranes. ABCA1 is a member of the ABC-A sub-family, which acts as a lipid translocator. The molecule was originally identified as a scavenger receptor on macrophages and research shows that ABCA1 also plays a major role in cholesterol metabolism. ABCA1 may play an important role in protecting against cardiovascular disease. Mutations in ABCA1 gene have been associated with Tangiers disease, a genetic disorder of lipid metabolism, and familial high density lipoprotein (HDL) deficiency., Application: Flow Cytometry (1:1), Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, 0.09% Sodium Azide, 5% Sucrose, 1% BSA, Reconstitutio: Reconstitute with distilled water., Storag: Store at 4°C. Do not freeze. Store undiluted. Protect from light. Microcentrifugation recommended if solution contains precipitate., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
502.00 € 502.0 EUR
Rat anti‑Mouse ABCA1 IgG2a Monoclonal RW-C188368-0.1
Antibody: ABCA1 Rat anti-Mouse Monoclonal (FITC) (5A1-1422) Antibody, Application: Flo, Reactivity: Mouse, Format: FITC, Unmodified, Descriptio: ABCA1 antibody RW-C188368 is an FITC-conjugated rat monoclonal antibody to mouse ABCA1. Validated for Flow., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a Monoclonal, Clon: 5A1-1422, Conjugation: FITC, Purificatio: Protein G purified, Modification: Unmodified, Immunoge: ABCA1 transfected HeLa cells., Specificit: Recognizes murine adenosine triphosphate (ATP) Binding cassette transporter 1 (ABCA1). The ABC transporters are a large family of conserved proteins that transport a wide variety of molecules across cellular membranes. ABCA1 is a member of the ABC-A sub-family, which acts as a lipid translocator. The molecule was originally identified as a scavenger receptor on macrophages and research shows that ABCA1 also plays a major role in cholesterol metabolism. ABCA1 may play an important role in protecting against cardiovascular disease. Mutations in ABCA1 gene have been associated with Tangiers disease, a genetic disorder of lipid metabolism, and familial high density lipoprotein (HDL) deficiency., Application: Flow Cytometry (1:1), Usag: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested., Presentatio: PBS, 0.09% Sodium Azide, 1% BSA, Storag: Store at 4°C or at -20°C. Store undiluted. Avoid freeze-thaw cycles. Protect from light. Microcentrifugation recommended if solution contains precipitate., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
444.00 € 444.0 EUR
Rat anti‑Mouse ABCA1 IgG2a Monoclonal RW-C188367-0.25
Antibody: ABCA1 Rat anti-Mouse Monoclonal (5A1-1422) Antibody, Application: IF, Flo, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: ABCA1 antibody RW-C188367 is an unconjugated rat monoclonal antibody to mouse ABCA1. Validated for Flow and IF., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a Monoclonal, Clon: 5A1-1422, Conjugation: Unconjugated, Purificatio: Protein G purified, Modification: Unmodified, Immunoge: ABCA1 transfected HeLa cells., Specificit: Recognizes murine adenosine triphosphate (ATP) Binding cassette transporter 1 (ABCA1). The ABC transporters are a large family of conserved proteins that transport a wide variety of molecules across cellular membranes. ABCA1 is a member of the ABC-A sub-family, which acts as a lipid translocator. The molecule was originally identified as a scavenger receptor on macrophages and research shows that ABCA1 also plays a major role in cholesterol metabolism. ABCA1 may play an important role in protecting against cardiovascular disease. Mutations in ABCA1 gene have been associated with Tangiers disease, a genetic disorder of lipid metabolism, and familial high density lipoprotein (HDL) deficiency., Application: Immunofluorescence
Flow Cytometry (1:10 - 1:200), Presentatio: PBS, 0.09% Sodium Azide, Storag: Store at 4°C or at -20°C. Store undiluted. Avoid freeze-thaw cycles. Microcentrifugation recommended if solution contains precipitate., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
486.00 € 486.0 EUR
Mouse anti‑Mouse ABCA1 IgG2b,k Monoclonal RW-C63373-100
Antibody: ABCA1 Mouse anti-Mouse Monoclonal (N-Terminus) Antibody, Application: WB, ELISA, Reactivity: Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ABCA1 antibody RW-C63373 is an unconjugated mouse monoclonal antibody to ABCA1 (N-Terminus) from mouse. It is reactive with mouse and rat. Validated for ELISA and WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Mouse, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG2b,k Monoclonal, Conjugation: Unconjugated, Purificatio: Protein G purified, Modification: Unmodified, Immunoge: Recombinant protein to the N-Terminus extracellular loop of mouse ABCA1., Epitop: N-Terminus, Specificit: Recognizes mouse ABCA1at ~220kD. Species cross-reactivity: rat., Application: Western blot (1:2000)
ELISA, Usag: Suitable for use in ELISA and Western Blot. Western Blot: 1:2000. Positive control: Mouse liver lysate., Presentatio: PBS, 0.1% Sodium Azide, Storag: Store at 4°C or -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
634.00 € 634.0 EUR
Rat anti‑Mouse ABCA1 IgG1,k Monoclonal RW-C63378-100
Antibody: ABCA1 Rat anti-Mouse Monoclonal (N-Terminus) Antibody, Application: WB, ELISA, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: ABCA1 antibody RW-C63378 is an unconjugated rat monoclonal antibody to mouse ABCA1 (N-Terminus). Validated for ELISA and WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG1,k Monoclonal, Conjugation: Unconjugated, Purificatio: Ascites, Modification: Unmodified, Immunoge: An A1-N3 peptide (within residues 200-250) of the mouse N-Terminus ABCA1 (chicken egg albumin by means of glutaraldehyde)., Epitop: N-Terminus, Specificit: Recognizes mouse ABCA1at ~250 kD. It does not react with human., Application: Western blot
ELISA, Failed Application: Flow Cytometry, Usag: Suitable for use in ELISA and Western Blot. Not suitable for FACS. Western Blot-1:1000-1:3000 (ECL). ABCA1 is known to aggregate. Do not boil samples. Use a reducing buffer: 2X sample buffer): 8 M Urea, 2% SDS, 715 mM BME, 1% glycerol, 0.001% Bromophenol Blue, 125 mM Tris-HCl, pH 6.8., Presentatio: Ascites fluid, 0.1% sodium azide, Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
649.00 € 649.0 EUR
Mouse anti‑Mouse ABCA1 IgG Monoclonal RW-C63367-100
Antibody: ABCA1 Mouse anti-Mouse Monoclonal (N-Terminus) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ABCA1 antibody RW-C63367 is an unconjugated mouse monoclonal antibody to ABCA1 (N-Terminus) from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Mouse, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Monoclonal, Conjugation: Unconjugated, Purificatio: Protein G purified, Modification: Unmodified, Immunoge: 50 kDa N-Terminus peptide containing the extracellular loop of ABCA1 (AA)., Epitop: N-Terminus, Specificit: Recognizes mouse and rat ABAC1. Low reactivity to human., Application: Western blot (1:2000), Usag: Suitable for use in Western Blot. Western Blot: 1:2000., Presentatio: PBS, 0.09% sodium azide, protease inhibitors., Storag: Short term: store at 4°C. Long term: store at -20°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
649.00 € 649.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C135137-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1271-1320) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: FITC HRP Biotin, Descriptio: ABCA1 antibody RW-C135137 is an unconjugated rabbit polyclonal antibody to mouse ABCA1 (aa1271-1320). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with FITC, HRP, Biotin., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa1271-1320 of mouse Abca1 (B1AWZ8, NP_038482). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse (100%); Galago, Marmoset, Bovine, Bat, Rabbit, Horse, Pig, Turkey, Zebra finch, Chicken (92%); Monkey, Rat, Hamster, Elephant, Dog, Guinea pig, Lizard (85%); Platypus (80%)., Epitop: aa1271-1320, Specificit: Mouse ABCA1, Application: Western blot (0.2 - 1 µg/ml), Usag: Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as secondary antibody., Presentatio: PBS, 0.09% sodium azide, 2% sucrose, Storag: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
424.00 € 424.0 EUR
Rat anti‑Mouse ABCA1 IgG2a Monoclonal RW-C126509-50
Antibody: ABCA1 Rat anti-Mouse Monoclonal Antibody, Application: IF, WB, Flo, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Biotin HRP, Descriptio: ABCA1 antibody RW-C126509 is an unconjugated rat monoclonal antibody to mouse ABCA1. Validated for Flow, IF and WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a Monoclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, HRP., Purificatio: Protein G purified, Modification: Unmodified, Immunoge: ABCA1 transfected HeLa cells., Specificit: Recognizes murine adenosine triphosphate (ATP) Binding cassette transporter 1 (ABCA1)., Application: Immunofluorescence
Western blot
Flow Cytometry (1:10 - 1:200), Usag: Suitable for use in Flow Cytometry, Immunofluorescence, and Western Blot. Flow Cytometry: 1:10-1:200; 10 ul labels 10^6 cells in 100ul., Presentatio: PBS, pH 7.4, 0.09% Sodium Azide, Storag: May be stored at 4°C for short-term only. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C. Aliquots are stable for up to 1 year at -20°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
763.00 € 763.0 EUR
Rat anti‑Mouse ABCA1 IgG2a,k Monoclonal RW-C2752-0.1
Antibody: ABCA1 Rat anti-Mouse Monoclonal (5A1-1422.11) Antibody, Application: Flo, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: ABCA1 antibody RW-C2752 is an unconjugated rat monoclonal antibody to mouse ABCA1. Validated for Flow., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG2a,k Monoclonal, Clon: 5A1-1422.11, Conjugation: Unconjugated, Purificatio: Ascites, Modification: Unmodified, Immunoge: Mouse ABCA1-expressing HeLa stable transfectants., Specificit: ABCA1., Application: Flow Cytometry (1:1000 - 1:30000), Failed Application: Western blot
ELISA, Presentatio: 0.1% Sodium Azide, Storag: Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
386.00 € 386.0 EUR
Rat anti‑Mouse ABCA1 IgG1,k Monoclonal RW-C2751-0.1
Antibody: ABCA1 Rat anti-Mouse Monoclonal (aa200-250) (3A1.891.3) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Descriptio: ABCA1 antibody RW-C2751 is an unconjugated rat monoclonal antibody to mouse ABCA1 (aa200-250). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rat, Reactivit: Mouse (tested or 100% immunogen sequence identity), Non-Reactivit: Human, Clonalit: IgG1,k Monoclonal, Clon: 3A1.891.3, Conjugation: Unconjugated, Purificatio: Ascites, Modification: Unmodified, Immunoge: An A1-N3 peptide (within residues 200-250) of the mouse ABCA1 protein covalently linked to chicken egg albumin by means of glutaraldehyde, Epitop: aa200-250, Specificit: ABCA1., Application: Western blot (1:1000 - 1:3000), Presentatio: 0.1% Sodium Azide, Storag: Short term: -20°C; Long term: -70°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
386.00 € 386.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C739518-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1404-1663) (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABCA1 antibody RW-C739518 is an APC-conjugated rabbit polyclonal antibody to mouse ABCA1 (aa1404-1663). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA1 (Leu1404-Phe1663) expressed in E. coli., Epitop: aa1404-1663, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA1., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
2,395.00 € 2395.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C723354-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1404-1663) (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABCA1 antibody RW-C723354 is a PE-conjugated rabbit polyclonal antibody to mouse ABCA1 (aa1404-1663). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA1 (Leu1404-Phe1663) expressed in E. coli., Epitop: aa1404-1663, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA1., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
2,395.00 € 2395.0 EUR
Rabbit anti‑Mouse ABCA1 Polyclonal RW-C732348-100
Antibody: ABCA1 Rabbit anti-Mouse Polyclonal (aa1404-1663) (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABCA1 antibody RW-C732348 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse ABCA1 (aa1404-1663). Validated for WB., Targe: Mouse ABCA1, Synonym: ABCA1 | ABC-1 | ABC1 | CERP | HDLDT1 | Tangier disease | ATP-binding cassette 1 | Td | Membrane-bound | TGD, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant ABCA1 (Leu1404-Phe1663) expressed in E. coli., Epitop: aa1404-1663, Specificit: The antibody is a rabbit polyclonal antibody raised against ABCA1., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: O95477 NCBI: NM_005502 NP_005493.2
3,592.00 € 3592.0 EUR
Rabbit anti‑Mouse ABAT Polyclonal RW-C695060-100
Antibody: ABAT Rabbit anti-Mouse Polyclonal (FITC) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: ABAT antibody RW-C695060 is an FITC-conjugated rabbit polyclonal antibody to ABAT from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABAT, Synonym: ABAT | 4-aminobutyrate transaminase | GABA aminotransferase | L-AIBAT | GABA transaminase | NPD009 | GABA transferase | GABA-AT | GABA-T | GABAT, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABAT, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABAT., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABA: Uniprot: P80404 NCBI: NM_000663 NP_000654.2
1,765.00 € 1765.0 EUR
Rabbit anti‑Mouse ABAT Polyclonal RW-C718467-100
Antibody: ABAT Rabbit anti-Mouse Polyclonal (APC) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: ABAT antibody RW-C718467 is an APC-conjugated rabbit polyclonal antibody to ABAT from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABAT, Synonym: ABAT | 4-aminobutyrate transaminase | GABA aminotransferase | L-AIBAT | GABA transaminase | NPD009 | GABA transferase | GABA-AT | GABA-T | GABAT, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABAT, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABAT., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABA: Uniprot: P80404 NCBI: NM_000663 NP_000654.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABAT Polyclonal RW-C712808-100
Antibody: ABAT Rabbit anti-Mouse Polyclonal (HRP) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: ABAT antibody RW-C712808 is an HRP-conjugated rabbit polyclonal antibody to ABAT from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABAT, Synonym: ABAT | 4-aminobutyrate transaminase | GABA aminotransferase | L-AIBAT | GABA transaminase | NPD009 | GABA transferase | GABA-AT | GABA-T | GABAT, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABAT, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABAT., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABA: Uniprot: P80404 NCBI: NM_000663 NP_000654.2
1,639.00 € 1639.0 EUR
Rabbit anti‑Mouse ABAT Polyclonal RW-C703785-100
Antibody: ABAT Rabbit anti-Mouse Polyclonal (Cy3) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: ABAT antibody RW-C703785 is a Cy3-conjugated rabbit polyclonal antibody to ABAT from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABAT, Synonym: ABAT | 4-aminobutyrate transaminase | GABA aminotransferase | L-AIBAT | GABA transaminase | NPD009 | GABA transferase | GABA-AT | GABA-T | GABAT, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABAT, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABAT., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABA: Uniprot: P80404 NCBI: NM_000663 NP_000654.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABAT Polyclonal RW-C688149-100
Antibody: ABAT Rabbit anti-Mouse Polyclonal (Biotin) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: ABAT antibody RW-C688149 is a biotin-conjugated rabbit polyclonal antibody to ABAT from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABAT, Synonym: ABAT | 4-aminobutyrate transaminase | GABA aminotransferase | L-AIBAT | GABA transaminase | NPD009 | GABA transferase | GABA-AT | GABA-T | GABAT, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABAT, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABAT., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABA: Uniprot: P80404 NCBI: NM_000663 NP_000654.2
1,387.00 € 1387.0 EUR
Rabbit anti‑Mouse ABAT Polyclonal RW-C663444-100
Antibody: ABAT Rabbit anti-Mouse Polyclonal Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: ABAT antibody RW-C663444 is an unconjugated rabbit polyclonal antibody to ABAT from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABAT, Synonym: ABAT | 4-aminobutyrate transaminase | GABA aminotransferase | L-AIBAT | GABA transaminase | NPD009 | GABA transferase | GABA-AT | GABA-T | GABAT, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABAT, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABAT., Application: Western blot, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABA: Uniprot: P80404 NCBI: NM_000663 NP_000654.2
1,261.00 € 1261.0 EUR
Rabbit anti‑Mouse ABAT Polyclonal RW-C726869-100
Antibody: ABAT Rabbit anti-Mouse Polyclonal (PE) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: ABAT antibody RW-C726869 is a PE-conjugated rabbit polyclonal antibody to ABAT from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABAT, Synonym: ABAT | 4-aminobutyrate transaminase | GABA aminotransferase | L-AIBAT | GABA transaminase | NPD009 | GABA transferase | GABA-AT | GABA-T | GABAT, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABAT, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABAT., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABA: Uniprot: P80404 NCBI: NM_000663 NP_000654.2
2,521.00 € 2521.0 EUR
Rabbit anti‑Mouse ABAT Polyclonal RW-C735795-100
Antibody: ABAT Rabbit anti-Mouse Polyclonal (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Rat, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: ABAT antibody RW-C735795 is an APC, Cy7-conjugated rabbit polyclonal antibody to ABAT from mouse. It is reactive with mouse and rat. Validated for WB., Targe: Mouse ABAT, Synonym: ABAT | 4-aminobutyrate transaminase | GABA aminotransferase | L-AIBAT | GABA transaminase | NPD009 | GABA transferase | GABA-AT | GABA-T | GABAT, Hos: Rabbit, Reactivit: Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: ABAT, Mouse, Specificit: The antibody is a rabbit polyclonal antibody raised against ABAT., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300., Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABA: Uniprot: P80404 NCBI: NM_000663 NP_000654.2
3,781.00 € 3781.0 EUR
Rabbit anti‑Mouse AATK / AATYK Polyclonal RW-C698308-100
Antibody: AATK / AATYK Rabbit anti-Mouse Polyclonal (aa137-386) (Cy3) Antibody, Application: WB, Reactivity: Mouse, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: AATYK antibody RW-C698308 is a Cy3-conjugated rabbit polyclonal antibody to mouse AATYK (AATK) (aa137-386). Validated for WB., Targe: Mouse AATK / AATYK, Synonym: AATK | AATYK | AATYK1 | CDK5-binding protein | Lemur tyrosine kinase 1 | p35-binding protein | p35BP | KIAA0641 | LMR1 | LMTK1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATK (Tyr137-Gln386) expressed in E. coli., Epitop: aa137-386, Specificit: The antibody is a rabbit polyclonal antibody raised against AATK., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AATK / AATY: Uniprot: Q6ZMQ8 NCBI: AB014541 BAA31616.2
2,269.00 € 2269.0 EUR
Rabbit anti‑Mouse AATK / AATYK Polyclonal RW-C690731-100
Antibody: AATK / AATYK Rabbit anti-Mouse Polyclonal (aa137-386) (FITC) Antibody, Application: WB, Reactivity: Mouse, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: AATYK antibody RW-C690731 is an FITC-conjugated rabbit polyclonal antibody to mouse AATYK (AATK) (aa137-386). Validated for WB., Targe: Mouse AATK / AATYK, Synonym: AATK | AATYK | AATYK1 | CDK5-binding protein | Lemur tyrosine kinase 1 | p35-binding protein | p35BP | KIAA0641 | LMR1 | LMTK1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATK (Tyr137-Gln386) expressed in E. coli., Epitop: aa137-386, Specificit: The antibody is a rabbit polyclonal antibody raised against AATK., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AATK / AATY: Uniprot: Q6ZMQ8 NCBI: AB014541 BAA31616.2
1,588.00 € 1588.0 EUR
Rabbit anti‑Mouse AATK / AATYK Polyclonal RW-C715579-100
Antibody: AATK / AATYK Rabbit anti-Mouse Polyclonal (aa137-386) (APC) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: AATYK antibody RW-C715579 is an APC-conjugated rabbit polyclonal antibody to mouse AATYK (AATK) (aa137-386). Validated for WB., Targe: Mouse AATK / AATYK, Synonym: AATK | AATYK | AATYK1 | CDK5-binding protein | Lemur tyrosine kinase 1 | p35-binding protein | p35BP | KIAA0641 | LMR1 | LMTK1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATK (Tyr137-Gln386) expressed in E. coli., Epitop: aa137-386, Specificit: The antibody is a rabbit polyclonal antibody raised against AATK., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AATK / AATY: Uniprot: Q6ZMQ8 NCBI: AB014541 BAA31616.2
2,269.00 € 2269.0 EUR
Rabbit anti‑Mouse AATK / AATYK Polyclonal RW-C707334-100
Antibody: AATK / AATYK Rabbit anti-Mouse Polyclonal (aa137-386) (HRP) Antibody, Application: WB, Reactivity: Mouse, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: AATYK antibody RW-C707334 is an HRP-conjugated rabbit polyclonal antibody to mouse AATYK (AATK) (aa137-386). Validated for WB., Targe: Mouse AATK / AATYK, Synonym: AATK | AATYK | AATYK1 | CDK5-binding protein | Lemur tyrosine kinase 1 | p35-binding protein | p35BP | KIAA0641 | LMR1 | LMTK1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATK (Tyr137-Gln386) expressed in E. coli., Epitop: aa137-386, Specificit: The antibody is a rabbit polyclonal antibody raised against AATK., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AATK / AATY: Uniprot: Q6ZMQ8 NCBI: AB014541 BAA31616.2
1,475.00 € 1475.0 EUR
Rabbit anti‑Mouse AATK / AATYK Polyclonal RW-C684488-100
Antibody: AATK / AATYK Rabbit anti-Mouse Polyclonal (aa137-386) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: AATYK antibody RW-C684488 is a biotin-conjugated rabbit polyclonal antibody to mouse AATYK (AATK) (aa137-386). Validated for WB., Targe: Mouse AATK / AATYK, Synonym: AATK | AATYK | AATYK1 | CDK5-binding protein | Lemur tyrosine kinase 1 | p35-binding protein | p35BP | KIAA0641 | LMR1 | LMTK1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATK (Tyr137-Gln386) expressed in E. coli., Epitop: aa137-386, Specificit: The antibody is a rabbit polyclonal antibody raised against AATK., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AATK / AATY: Uniprot: Q6ZMQ8 NCBI: AB014541 BAA31616.2
1,248.00 € 1248.0 EUR
Rabbit anti‑Mouse AATK / AATYK Polyclonal RW-C292918-100
Antibody: AATK / AATYK Rabbit anti-Mouse Polyclonal (aa137-386) Antibody, Application: WB, Reactivity: Mouse, Format: Unconjugated, Unmodified, Other formats: Unconjugated, Unmodified, Descriptio: AATYK antibody RW-C292918 is an unconjugated rabbit polyclonal antibody to mouse AATYK (AATK) (aa137-386). Validated for WB., Targe: Mouse AATK / AATYK, Synonym: AATK | AATYK | AATYK1 | CDK5-binding protein | Lemur tyrosine kinase 1 | p35-binding protein | p35BP | KIAA0641 | LMR1 | LMTK1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATK (Tyr137-Gln386) expressed in E. coli., Epitop: aa137-386, Specificit: The antibody is a rabbit polyclonal antibody raised against AATK., Application: Western blot (1:100 - 1:400), Usag: ELISA 1:100-1:5000; ICC 1:50-500; WB 1:50-400;, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AATK / AATY: Uniprot: Q6ZMQ8 NCBI: AB014541 BAA31616.2
1,161.00 € 1161.0 EUR
Rabbit anti‑Mouse AATK / AATYK Polyclonal RW-C721393-100
Antibody: AATK / AATYK Rabbit anti-Mouse Polyclonal (aa137-386) (PE) Antibody, Application: WB, Reactivity: Mouse, Format: Phycoerythrin, Unmodified, Other formats: Phycoerythrin, Unmodified, Descriptio: AATYK antibody RW-C721393 is a PE-conjugated rabbit polyclonal antibody to mouse AATYK (AATK) (aa137-386). Validated for WB., Targe: Mouse AATK / AATYK, Synonym: AATK | AATYK | AATYK1 | CDK5-binding protein | Lemur tyrosine kinase 1 | p35-binding protein | p35BP | KIAA0641 | LMR1 | LMTK1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Phycoerythrin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATK (Tyr137-Gln386) expressed in E. coli., Epitop: aa137-386, Specificit: The antibody is a rabbit polyclonal antibody raised against AATK., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AATK / AATY: Uniprot: Q6ZMQ8 NCBI: AB014541 BAA31616.2
2,269.00 € 2269.0 EUR
Rabbit anti‑Mouse AATK / AATYK Polyclonal RW-C730398-100
Antibody: AATK / AATYK Rabbit anti-Mouse Polyclonal (aa137-386) (APC, Cy7) Antibody, Application: WB, Reactivity: Mouse, Format: Allophycocyanin, Cy7, Unmodified, Other formats: Allophycocyanin, Cy7, Unmodified, Descriptio: AATYK antibody RW-C730398 is an APC, Cy7-conjugated rabbit polyclonal antibody to mouse AATYK (AATK) (aa137-386). Validated for WB., Targe: Mouse AATK / AATYK, Synonym: AATK | AATYK | AATYK1 | CDK5-binding protein | Lemur tyrosine kinase 1 | p35-binding protein | p35BP | KIAA0641 | LMR1 | LMTK1, Hos: Rabbit, Reactivit: Mouse (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin, Cy7. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, APC, PE., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATK (Tyr137-Gln386) expressed in E. coli., Epitop: aa137-386, Specificit: The antibody is a rabbit polyclonal antibody raised against AATK., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AATK / AATY: Uniprot: Q6ZMQ8 NCBI: AB014541 BAA31616.2
3,403.00 € 3403.0 EUR
Rabbit anti‑Mouse AATF Polyclonal RW-C698335-100
Antibody: AATF Rabbit anti-Mouse Polyclonal (aa240-438) (Cy3) Antibody, Application: WB, Reactivity: Mouse, Human, Format: Cy3, Unmodified, Other formats: Cy3, Unmodified, Descriptio: AATF antibody RW-C698335 is a Cy3-conjugated rabbit polyclonal antibody to AATF (aa240-438) from mouse. It is reactive with human and mouse. Validated for WB., Targe: Mouse AATF, Synonym: AATF | CHE1 | DED | Rb-binding protein Che-1 | CHE-1 | Protein AATF, Hos: Rabbit, Reactivit: Mouse, Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Cy3. Also available Unconjugated or conjugated with Biotin, FITC, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATF (Ser240-Ile438) expressed in E. coli., Epitop: aa240-438, Specificit: The antibody is a rabbit polyclonal antibody raised against AATF., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AAT: Uniprot: Q9NY61 NCBI: NM_012138 NP_036270.1
2,269.00 € 2269.0 EUR
Rabbit anti‑Mouse AATF Polyclonal RW-C690749-100
Antibody: AATF Rabbit anti-Mouse Polyclonal (aa240-438) (FITC) Antibody, Application: WB, Reactivity: Mouse, Human, Format: FITC, Unmodified, Other formats: FITC, Unmodified, Descriptio: AATF antibody RW-C690749 is an FITC-conjugated rabbit polyclonal antibody to AATF (aa240-438) from mouse. It is reactive with human and mouse. Validated for WB., Targe: Mouse AATF, Synonym: AATF | CHE1 | DED | Rb-binding protein Che-1 | CHE-1 | Protein AATF, Hos: Rabbit, Reactivit: Mouse, Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: FITC. Also available Unconjugated or conjugated with Biotin, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATF (Ser240-Ile438) expressed in E. coli., Epitop: aa240-438, Specificit: The antibody is a rabbit polyclonal antibody raised against AATF., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AAT: Uniprot: Q9NY61 NCBI: NM_012138 NP_036270.1
1,588.00 € 1588.0 EUR
Rabbit anti‑Mouse AATF Polyclonal RW-C715592-100
Antibody: AATF Rabbit anti-Mouse Polyclonal (aa240-438) (APC) Antibody, Application: WB, Reactivity: Mouse, Human, Format: Allophycocyanin, Unmodified, Other formats: Allophycocyanin, Unmodified, Descriptio: AATF antibody RW-C715592 is an APC-conjugated rabbit polyclonal antibody to AATF (aa240-438) from mouse. It is reactive with human and mouse. Validated for WB., Targe: Mouse AATF, Synonym: AATF | CHE1 | DED | Rb-binding protein Che-1 | CHE-1 | Protein AATF, Hos: Rabbit, Reactivit: Mouse, Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Allophycocyanin. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, HRP, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATF (Ser240-Ile438) expressed in E. coli., Epitop: aa240-438, Specificit: The antibody is a rabbit polyclonal antibody raised against AATF., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AAT: Uniprot: Q9NY61 NCBI: NM_012138 NP_036270.1
2,269.00 € 2269.0 EUR
Rabbit anti‑Mouse AATF Polyclonal RW-C707357-100
Antibody: AATF Rabbit anti-Mouse Polyclonal (aa240-438) (HRP) Antibody, Application: WB, Reactivity: Mouse, Human, Format: Horseradish Peroxidase, Unmodified, Other formats: Horseradish Peroxidase, Unmodified, Descriptio: AATF antibody RW-C707357 is an HRP-conjugated rabbit polyclonal antibody to AATF (aa240-438) from mouse. It is reactive with human and mouse. Validated for WB., Targe: Mouse AATF, Synonym: AATF | CHE1 | DED | Rb-binding protein Che-1 | CHE-1 | Protein AATF, Hos: Rabbit, Reactivit: Mouse, Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Horseradish Peroxidase. Also available Unconjugated or conjugated with Biotin, FITC, Cy3, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATF (Ser240-Ile438) expressed in E. coli., Epitop: aa240-438, Specificit: The antibody is a rabbit polyclonal antibody raised against AATF., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AAT: Uniprot: Q9NY61 NCBI: NM_012138 NP_036270.1
1,475.00 € 1475.0 EUR
Rabbit anti‑Mouse AATF Polyclonal RW-C684503-100
Antibody: AATF Rabbit anti-Mouse Polyclonal (aa240-438) (Biotin) Antibody, Application: WB, Reactivity: Mouse, Human, Format: Biotin, Unmodified, Other formats: Biotin, Unmodified, Descriptio: AATF antibody RW-C684503 is a biotin-conjugated rabbit polyclonal antibody to AATF (aa240-438) from mouse. It is reactive with human and mouse. Validated for WB., Targe: Mouse AATF, Synonym: AATF | CHE1 | DED | Rb-binding protein Che-1 | CHE-1 | Protein AATF, Hos: Rabbit, Reactivit: Mouse, Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Biotin. Also available Unconjugated or conjugated with FITC, Cy3, HRP, APC, PE, APC, Cy7., Purificatio: Antigen-specific affinity chromatography followed by Protein A affinity chromatography, Modification: Unmodified, Immunoge: Recombinant AATF (Ser240-Ile438) expressed in E. coli., Epitop: aa240-438, Specificit: The antibody is a rabbit polyclonal antibody raised against AATF., Application: Western blot
Applications tested for the base form of this product only, Presentatio: PBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, Storag: Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20°C for 12 months., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AAT: Uniprot: Q9NY61 NCBI: NM_012138 NP_036270.1
1,248.00 € 1248.0 EUR